Recombinant Thermosipho melanesiensis Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Mechanism of Cobalt Transport

CbiM operates within the CbiMNQO transporter complex, utilizing ATP hydrolysis for active cobalt uptake :

  • Substrate Binding: Cobalt coordination occurs via the N-terminal loop of CbiM, facilitated by dynamic interactions with the auxiliary protein CbiN.

  • Conformational Changes: ATP binding to CbiO (ATPase subunit) triggers a closed conformation, while product release induces a toppling motion in CbiQ and CbiM to extrude cobalt .

  • Role of CbiN: The 37-aa extracellular loop of CbiN stabilizes CbiM’s N-terminal loop, enabling metal insertion. Deletions in this loop abolish transport activity .

Functional Insights from Mutational Studies

  • CbiN Loop Interactions: Cysteine-scanning mutagenesis confirmed that CbiN’s loop residues (e.g., Gly³⁷, Asp⁴⁰) directly contact CbiM’s L0 and L1 loops. Crosslinking these regions immobilizes the N-terminal loop, disrupting cobalt binding .

  • ATPase Activity: The CbiMQO subcomplex (without CbiN) retains basal ATP hydrolysis (0.8 μmol/min/mg), suggesting CbiN modulates rather than enables transport .

Evolutionary and Genomic Context

T. melanesiensis genomes exhibit CRISPR-cas Type III and restriction-modification (RM) systems, limiting horizontal gene transfer (HGT) and mobile element proliferation . Despite this, CbiM’s conservation across Thermosipho spp. underscores its essential role in cobalt acquisition, particularly in hydrothermal vent ecosystems where cobalt is scarce .

Applications and Research Implications

  • Biotechnology: Recombinant CbiM serves as a model for studying metal transport mechanisms in extremophiles.

  • Structural Biology: Cryo-EM structures of CbiMQO provide templates for engineering synthetic transporters .

  • Environmental Adaptation: Insights into cobalt uptake mechanisms inform microbial survival strategies in oligotrophic environments .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbiM; Tmel_0712; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-235
Protein Length
Full Length of Mature Protein
Species
Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Target Names
cbiM
Target Protein Sequence
LIWYILSLPFFVIGLFTIRKTIKEKPNLKMLLAFVGAFTFVLSAMKIPSVTGSCSHPTGI GLGAIIFGPFTMTVIGTIVLLFQALLLAHGGLTTLGANTFSMAIVGSLVSYFIYKSLYKK NRNIAVFLAAFLGDLFTYVTTSFQLAVAFPDKTHGFIFSLAKFLSIFAITQVPLAIIEGL VTVVVIDLIYKYNKNELFEEGL
Uniprot No.

Target Background

Function
This protein is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CbiM protein and what is its role in cobalt transport?

CbiM is a substrate-specific integral membrane protein that serves as the S-component of the CbiMNQO₂ cobalt transport system in thermophilic bacteria. This transport complex belongs to the Energy-Coupling Factor (ECF) family of ATP-binding cassette (ABC) transporters, which are responsible for the uptake of various micronutrients in prokaryotes. The CbiM protein specifically binds cobalt ions (Co²⁺) at the extracellular surface and facilitates their translocation across the cell membrane. As the primary cobalt-binding component, CbiM contains metal-coordinating residues in its transmembrane domains that are essential for substrate specificity and transport efficiency .

The function of CbiM is particularly important because cobalt is an essential cofactor for vitamin B12 synthesis, which is critical for various metabolic processes in many microorganisms. Studies have shown that Thermosipho species have acquired genes for vitamin B12 synthesis through horizontal gene transfer, making efficient cobalt uptake systems crucial for their metabolism .

Interestingly, CbiM alone has limited transport activity but functions efficiently when associated with the auxiliary membrane protein CbiN. The CbiM-CbiN interaction has been demonstrated to significantly enhance cobalt transport activity, even in the absence of the energy-coupling components CbiQO₂ .

How does the structure of CbiM relate to its function?

The CbiM protein consists of multiple transmembrane helices that span the cell membrane, creating a pathway for cobalt ions to cross the hydrophobic barrier. The protein contains specific metal-binding ligands, likely including histidine, aspartate, or glutamate residues, which coordinate the cobalt ion during transport. A critical feature of CbiM's structure is its N-terminal loop region, which contains three of the four metal ligands necessary for cobalt binding .

This N-terminal region plays a crucial role in the transport mechanism, as it becomes partially immobilized during the functional transport cycle. Studies have shown that mutations or deletions in this region severely impair transport activity, highlighting its importance in the transport process . The conformational changes in CbiM during the transport cycle are essential for its function. Like other ECF transporters, CbiM likely undergoes a topological rearrangement during transport, exposing the substrate-binding site alternately to the extracellular environment and the cytoplasm.

Structural analyses using techniques such as electron paramagnetic resonance (EPR) spectroscopy have provided insights into the dynamics of the CbiM protein, particularly regarding the mobility changes in key regions during the transport cycle. These studies have revealed that the interaction with CbiN induces specific conformational changes in CbiM that are essential for transport activity .

What is the relationship between CbiM and CbiN in the cobalt transport system?

The interaction between CbiM and CbiN represents a critical functional partnership in the cobalt transport system. CbiN is a small membrane protein comprising two transmembrane helices connected by an extracytoplasmic loop of approximately 37 amino acid residues. This auxiliary protein temporarily interacts with CbiM to facilitate cobalt transport through several key mechanisms .

First, the extracytoplasmic loop of CbiN forms specific protein-protein contacts with loops in the CbiM protein. These interactions have been confirmed through in silico predictions, cysteine-scanning mutagenesis, and crosslinking experiments. The CbiN loop adopts an ordered structure when interacting with CbiM, as demonstrated by electron paramagnetic resonance analysis .

Second, the interaction between CbiM and CbiN induces conformational changes in the N-terminal loop of CbiM, which contains critical metal-binding ligands. In functional transporters, this loop is partially immobilized, whereas in inactive variants with CbiN loop deletions, the loop becomes completely immobile .

Studies have shown that any deletion in the CbiN loop abolishes transport activity, highlighting the critical nature of this interaction. Moreover, the CbiM-CbiN interaction is sufficient to induce significant cobalt transport activity even in the absence of the energy-coupling components (CbiQO₂), suggesting that this interaction is a primary determinant of transport function .

This relationship provides important insights into how auxiliary components can modulate the function of substrate-binding proteins in transport systems, representing an important mechanism in the evolution of membrane transporters.

What expression systems are optimal for recombinant CbiM production?

Expressing functional membrane proteins like CbiM presents significant challenges due to their hydrophobic nature and complex folding requirements. Several expression systems have been developed for the production of recombinant CbiM, each with specific advantages for different research applications.

For initial expression trials, E. coli-based systems remain the most widely used platforms due to their simplicity and scalability. For CbiM expression, E. coli strains specifically designed for membrane protein production (such as C41(DE3), C43(DE3), or Lemo21(DE3)) have shown better results than standard strains. Expression is typically driven using T7 promoter-based vectors with careful optimization of induction conditions including reduced temperature (16-20°C), lower inducer concentrations, and extended induction times .

Given that T. melanesiensis is a thermophile with an optimal growth temperature around 70°C, expression in moderate thermophiles like Thermus thermophilus might provide a more native-like environment for proper folding of CbiM. These systems may be particularly valuable when investigating temperature-dependent aspects of CbiM function or when thermostability is required for downstream applications .

Most importantly, since CbiM functions in concert with CbiN, co-expression strategies have proven highly effective. Studies have shown that CbiM and CbiN co-expression or expression of a Cbi(MN) fusion protein can induce significant cobalt transport activity, suggesting that the interaction between these proteins enhances proper folding and stability . This approach can be implemented using either dual-plasmid systems or single constructs encoding both proteins.

For structural studies, cell-free expression systems supplemented with lipids or detergents have also shown promise for producing functional CbiM protein while bypassing some of the toxicity issues associated with membrane protein overexpression in living cells.

What are the challenges in purifying functional CbiM protein?

Purification of integral membrane proteins like CbiM presents several unique challenges that must be addressed to obtain functional protein for biochemical and structural studies. The first critical step involves selecting appropriate detergents for solubilization without denaturing the protein. For thermophilic membrane proteins like CbiM, mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or digitonin have shown better success in maintaining protein stability compared to harsher detergents .

Maintaining protein stability throughout the purification process represents another significant challenge. CbiM, like many membrane transporters, can be unstable once removed from the lipid bilayer. Strategies to enhance stability during purification include adding lipids or lipid-like molecules, including cobalt ions in buffers to stabilize the substrate-binding site, performing purification steps at lower temperatures, and using stabilizing additives such as glycerol or specific salt concentrations.

When purifying the functional CbiM-CbiN complex, conditions must be optimized to maintain their interaction. This often involves co-purification strategies using tandem affinity tags or fusion constructs. Studies have shown that the interaction between these proteins is critical for transport function, making it essential to preserve this interaction during purification .

A particular consideration for CbiM from thermophilic organisms is their adaptation to high temperatures. While this can be advantageous for some purification steps, it may complicate others, particularly when working with detergent-solubilized proteins at lower temperatures. Temperature optimization during each purification step is therefore crucial for maintaining protein stability and function.

Finally, assessing protein quality using methods such as circular dichroism spectroscopy, metal-binding assays, and functional reconstitution into proteoliposomes is essential to verify that purified CbiM retains its native conformation and cobalt-binding activity.

How can the stability of recombinant CbiM be improved?

Enhancing the stability of recombinant CbiM is crucial for structural and functional studies. Several effective strategies have been developed to address the inherent instability of membrane proteins during expression, purification, and characterization.

Protein engineering approaches offer powerful tools for improving CbiM stability. These include the introduction of thermostabilizing mutations identified through computational prediction or directed evolution, creation of fusion constructs with well-folded soluble proteins, and design of disulfide bonds to stabilize specific conformations. The generation of CbiM-CbiN fusion proteins has been shown to enhance transport activity and potentially stability, providing a valuable approach for obtaining functional protein .

Optimization of buffer conditions represents another critical strategy. This involves screening different pH values (typically in the range of pH 6.5-8.0), including specific ions that enhance stability, adding osmolytes such as glycerol or sucrose, and incorporating cholesterol hemisuccinate (CHS) or other lipid-like molecules to mimic the native membrane environment.

Alternative solubilization strategies have emerged as powerful approaches for maintaining membrane protein stability. These include the use of lipid nanodiscs, which provide a more native-like membrane environment, application of styrene-maleic acid lipid particles (SMALPs) for extraction with the surrounding lipid environment, and amphipol-based approaches for detergent-free handling after initial extraction.

For thermophilic proteins like CbiM from T. melanesiensis, leveraging their natural thermostability can be advantageous. This might involve performing critical purification steps at elevated temperatures when possible and using thermostable detergents or nanodiscs for high-temperature applications .

Finally, stabilization through ligand binding can significantly enhance protein stability. This includes the addition of cobalt or other substrate analogs that stabilize specific conformations and co-purification with binding partners like CbiN or antibody fragments that lock the protein in stable conformations.

What techniques are most effective for studying CbiM-mediated cobalt transport?

Investigating the transport function of CbiM requires a combination of complementary techniques that probe different aspects of its activity. Whole-cell transport assays represent one of the most direct approaches for studying CbiM function. These include radioisotope-based uptake assays using ⁵⁷Co or ⁶⁰Co, competition assays with other divalent metals to assess specificity, and growth complementation assays in cobalt-dependent bacterial strains .

For more controlled studies, reconstituted systems provide valuable tools. These include proteoliposome-based transport assays with purified components, solid-supported membrane electrophysiology, and fluorescence-based assays using cobalt-sensitive fluorophores. These approaches allow precise control over the composition of the transport system and the experimental conditions, enabling detailed mechanistic studies .

Metal binding studies provide critical insights into the substrate recognition properties of CbiM. Techniques such as isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamics, microscale thermophoresis (MST) for measuring interactions in solution, and equilibrium dialysis with radioactive cobalt can reveal the thermodynamic and kinetic parameters of metal binding.

To study the structural dynamics associated with transport, electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling has proven particularly valuable. This approach has been successfully used to monitor conformational changes in CbiM, especially in relation to its interaction with CbiN . Additional techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) and single-molecule FRET can provide further insights into the conformational changes associated with transport.

When studying the CbiM-CbiN interaction specifically, techniques such as crosslinking studies have proven particularly informative. In silico predicted protein-protein contacts between segments of the CbiN loop and loops in CbiM have been confirmed experimentally using cysteine-scanning mutagenesis and crosslinking, providing valuable insights into the structural basis of this functional interaction .

How can site-directed mutagenesis be used to study CbiM function?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships of CbiM and has been instrumental in identifying key functional elements of this transporter. One primary application is identifying metal coordination residues through systematic mutation of potential metal-coordinating amino acids (histidine, cysteine, aspartate, glutamate). Conservative substitutions (e.g., His→Gln, Asp→Asn) can distinguish between residues involved directly in metal coordination versus those playing structural roles .

For probing conformational changes during the transport cycle, strategic mutations can be highly informative. This includes the introduction of cysteine pairs for disulfide crosslinking to trap specific conformations, creation of reporter residues for spectroscopic techniques, and introduction of spin labels for EPR studies. Such approaches have been successfully applied to study the conformational changes in the CbiM N-terminal loop during transport .

Mapping interaction interfaces between CbiM and its partner proteins, particularly CbiN, has been another valuable application of site-directed mutagenesis. Alanine-scanning mutagenesis of regions predicted to interact with CbiN, coupled with cysteine mutagenesis and crosslinking studies, has validated protein-protein contacts and identified critical residues for this functional interaction .

Studies have shown that mutations in the N-terminal loop of CbiM, which contains three of the four metal ligands, can dramatically affect transport activity. Similarly, deletions in the CbiN loop have been demonstrated to abolish transport activity, highlighting critical regions for protein-protein interactions .

A systematic mutagenesis approach combined with functional assays can provide detailed insights into the transport mechanism and the specific roles of key residues in substrate recognition, protein-protein interactions, and conformational changes during the transport cycle. This information is essential for understanding the molecular basis of cobalt transport and for designing rational modifications to alter transport properties.

What biophysical methods are suitable for characterizing CbiM structure?

Elucidating the structural properties of membrane proteins like CbiM requires a multi-faceted approach combining various biophysical techniques. X-ray crystallography remains a gold standard for high-resolution structure determination, though it may require protein engineering to improve crystallizability and often utilizes lipidic cubic phase (LCP) crystallization for membrane proteins like CbiM. This approach can provide atomic-level details of the metal-binding site and protein-protein interfaces .

Cryo-electron microscopy (cryo-EM) has emerged as an increasingly powerful method for membrane protein structures, with recent advances allowing structures of smaller membrane proteins like CbiM. This technique may be particularly valuable for the CbiMNQO complex and can capture different conformational states relevant to the transport cycle.

For studying protein dynamics, spectroscopic approaches offer valuable insights. Electron Paramorphic Resonance (EPR) spectroscopy has been particularly successful for studying conformational changes in CbiM and has been applied to analyze the CbiM-CbiN interaction . This technique can measure distances between specifically labeled sites and provides information about protein dynamics during transport.

Nuclear Magnetic Resonance (NMR) spectroscopy can provide both structural and dynamic information, with solution NMR applicable for smaller fragments or domains and solid-state NMR suitable for intact membrane proteins. This approach can be particularly valuable for mapping protein-protein interaction interfaces between CbiM and CbiN.

Mass spectrometry-based approaches have also proven valuable, including hydrogen-deuterium exchange mass spectrometry (HDX-MS) for probing conformational dynamics, cross-linking mass spectrometry for mapping interaction interfaces, and native mass spectrometry to analyze intact complexes and subunit stoichiometry.

For CbiM specifically, EPR spectroscopy has been successfully employed to analyze the structural organization of the CbiN loop and its interactions with CbiM. These studies revealed that the CbiN loop adopts an ordered structure when interacting with CbiM and that the N-terminal loop of CbiM becomes partially immobilized in functional transporters .

How does T. melanesiensis CbiM compare to homologs in other species?

T. melanesiensis CbiM belongs to a wider family of ECF-type transporters found across diverse bacterial and archaeal species, providing interesting insights into evolutionary adaptations of metal transport systems. Comparative analysis reveals high sequence conservation among thermophilic organisms, with CbiM proteins from thermophilic species like T. melanesiensis, T. africanus, and T. affectus sharing high sequence identity (typically >70%) . These thermophilic CbiM proteins often contain specific adaptations for stability at high temperatures, such as increased proportions of charged residues and stronger ion-pair networks.

When compared with mesophilic homologs, T. melanesiensis CbiM shows moderate sequence identity (typically 30-50%), with key metal-binding residues and structural elements generally conserved across temperature adaptations. The differences often occur in loop regions and at protein-protein interfaces, reflecting adaptations to specific environmental conditions .

The genomic context of cbiM is highly conserved across bacterial lineages. In most Thermotogae, including T. melanesiensis, the cbiM gene is located in an operon with cbiN, cbiQ, and cbiO genes, suggesting functional co-evolution of these components . This genomic organization is preserved across diverse bacterial phyla, highlighting the evolutionary importance of maintaining these functional relationships.

From a structural perspective, the core membrane topology and key functional elements of CbiM are preserved across diverse species, while the critical extracytoplasmic loops involved in CbiM-CbiN interactions show higher sequence variability while maintaining functional interactions. The metal-binding sites are highly conserved, reflecting the specific requirements for cobalt coordination .

Comparative genomic analyses of Thermosipho species have revealed that differences in genome size and content correlate with habitat distribution. T. melanesiensis, which has a more specialized habitat distribution compared to T. africanus, shows specific adaptations in its transport systems, including cobalt transporters .

What can the evolution of CbiM tell us about adaptation to different environments?

The evolution of CbiM transporters provides valuable insights into microbial adaptation to diverse environments, particularly extreme habitats like hydrothermal vents. One key aspect is adaptation to metal availability in different environments. Thermophilic environments often have distinct metal availability profiles compared to mesophilic habitats, and the evolution of CbiM proteins reflects adaptations to acquire essential cobalt under varying environmental conditions .

Thermoadaptation features are particularly evident in CbiM proteins from thermophiles like T. melanesiensis. These include increased proportions of charged and hydrophobic residues, stronger ion-pair networks, and compact structural elements. The transmembrane domains often show enhanced hydrophobicity to maintain stability in the membrane at elevated temperatures, representing adaptations to the extreme conditions of hydrothermal vents .

Comparative genomics of Thermosipho species reveals that habitat distribution correlates with genome content differences. T. melanesiensis, which is found predominantly in deep-sea hydrothermal vents in the Pacific Ocean, shows specific adaptations in its transport systems compared to the more widely distributed T. africanus . These differences may reflect specialization to the unique geochemical conditions of different hydrothermal vent systems.

Interestingly, variations in metal transport systems across Thermosipho species correlate with differences in immune system composition. Species with more specialized habitats often show distinct patterns of genome streamlining and transport system adaptations. The presence or absence of mobile genetic elements, which can facilitate horizontal gene transfer of transport systems, correlates with immune system composition .

Genomic analyses indicate that cobalt transport systems, including CbiM, have been subject to horizontal gene transfer events across bacterial lineages. This is particularly evident in thermophiles, which show a higher proportion of horizontally acquired genes despite having smaller genomes . The acquisition of optimized transport systems may represent a key adaptation strategy in new environmental niches.

How is the CbiM-containing transporter related to vitamin B12 biosynthesis pathways?

The CbiM-containing cobalt transport system is intricately linked to vitamin B12 (cobalamin) biosynthesis pathways, representing a critical interface between metal acquisition and essential cofactor synthesis. Cobalt is an essential component of the corrin ring in vitamin B12, making its acquisition a prerequisite for B12 biosynthesis. The CbiMNQO transport system provides the dedicated pathway for cobalt uptake in many prokaryotes, including Thermosipho species .

Genomic analyses reveal that genes for cobalt transport are often co-localized or co-regulated with genes involved in B12 biosynthesis in Thermosipho genomes. Comparative genomic studies show that Thermosipho species have acquired genes for vitamin B12 synthesis through horizontal gene transfer, and this acquisition appears to have included the specialized cobalt transport systems required for B12 production .

Expression of cobalt transporters is often coordinated with B12 biosynthesis pathways through regulatory mechanisms. In many bacteria, including Thermosipho species, B12 riboswitches regulate the expression of both transport and biosynthetic genes . This ensures efficient resource allocation, with cobalt uptake systems being expressed when B12 synthesis is active.

The ability to synthesize vitamin B12 represents a significant metabolic advantage in many environments. Thermosipho species have acquired this capability, including the necessary cobalt transport systems, despite their generally streamlined genomes . This suggests strong selective pressure for maintaining these pathways in their ecological niches.

In Thermosipho species, genes for vitamin B12 metabolism are organized into four main clusters: the BtuFCD cluster (encoding an alternative cobalt/B12 transporter), the cobalt-specific CbiMNQO transporter cluster, the cobalamin biosynthesis gene cluster, and the B12-dependent metabolic enzyme cluster . This organization reflects the functional coordination between transport and metabolic pathways.

The presence of these transport and biosynthetic pathways in Thermosipho genomes likely reflects their adaptation to specific ecological niches where the ability to synthesize B12 provides a competitive advantage .

What are potential biotechnological applications of recombinant CbiM?

Recombinant CbiM protein from thermophilic organisms like T. melanesiensis offers several promising biotechnological applications across diverse fields. In environmental biotechnology, engineered CbiM-based systems could be developed for selective cobalt recovery from contaminated environments, creation of biosensors for detecting toxic levels of cobalt in environmental samples, and development of metal-accumulating bacteria for mining waste treatment .

The thermostability and metal-binding properties of CbiM make it an excellent template for protein engineering applications. These include designing metal transporters with altered specificities, developing thermostable membrane protein scaffolds for biotechnological applications, and creating metal-binding domains for protein-based materials .

In industrial biotechnology, optimized CbiM-based cobalt transport systems could enhance vitamin B12 production in industrial microorganisms. The understanding of how CbiM functions at high temperatures could inform the development of thermostable expression systems for industrial biocatalysis operating under harsh conditions .

The detailed structural understanding of CbiM and its interactions with partner proteins provides valuable frameworks for structural biology applications. These include using thermostable membrane proteins as models for structural studies, developing protein scaffolds for nanoparticle assembly, and designing thermostable protein purification tags .

The thermostability of T. melanesiensis CbiM provides particular advantages for applications requiring robust performance under harsh conditions or prolonged stability at elevated temperatures. Additionally, the understanding of protein-protein interactions in the CbiM-CbiN system offers valuable insights for designing engineered protein complexes with novel functions .

As research continues to elucidate the molecular mechanisms of CbiM function, new applications are likely to emerge, particularly in the fields of synthetic biology, metabolic engineering, and biomaterials design.

How might understanding CbiM function contribute to synthetic biology?

The detailed understanding of CbiM structure, function, and interactions provides valuable principles for synthetic biology applications across multiple domains. The modular architecture of the CbiMNQO system offers templates for designing synthetic transporters with novel specificities. The understanding of metal coordination chemistry can inform the design of synthetic binding sites for various metals and small molecules, while the protein-protein interaction interfaces between CbiM and CbiN provide design principles for engineering novel protein complexes .

For synthetic biology parts development, components derived from cobalt transport systems could be used to create metal-responsive genetic circuits. The well-characterized interactions between CbiM and its partner proteins offer templates for designing modular transport components for synthetic cell applications. Additionally, the thermostable nature of T. melanesiensis proteins provides valuable components for high-temperature bioprocesses .

In minimal cell applications, insights into essential transport functions can guide the design of simplified cellular systems. Understanding of the minimal components required for metal homeostasis can inform the implementation of streamlined transport systems in synthetic cell membranes and the integration of transport and metabolic pathways in minimal cell designs .

For synthetic membrane systems, the principles derived from CbiM structure and function can guide the design of artificial membranes with controlled transport properties. This could lead to the development of biomimetic membranes incorporating functional transport proteins and the creation of responsive materials with metal-dependent permeability .

The thermostability and modular nature of the CbiM-containing transport system make it particularly valuable as a template for synthetic biology applications requiring robust performance under challenging conditions. Furthermore, the understanding of how auxiliary proteins like CbiN modify transporter function provides design principles for creating switchable or regulatable transport systems for synthetic biology applications .

What are the key unanswered questions about CbiM that require further research?

Despite significant advances in understanding CbiM function, several important questions remain unanswered and represent promising directions for future research. From a structural perspective, the high-resolution structure of CbiM in different conformational states remains to be determined. Understanding how the protein undergoes conformational changes during the transport cycle and elucidating the precise coordination geometry of cobalt in the binding site are critical questions requiring further investigation .

The energetics of cobalt transport through the CbiMNQO system represents another area requiring further research. The precise mechanism of energy coupling in the complete system, how ATP hydrolysis by the CbiO components is transduced to drive conformational changes, and how the thermophilic nature of T. melanesiensis CbiM affects transport energetics are all questions that remain to be fully addressed .

Metal selectivity mechanisms represent another important area for future research. Understanding the molecular determinants of cobalt selectivity over other divalent metals, how subtle variations in the binding site affect metal preference, and whether selectivity can be rationally modified to transport other biologically relevant metals are questions with significant implications for both basic science and applications .

From an evolutionary perspective, several questions remain about how CbiM proteins have evolved in response to different environmental metal availabilities, the evolutionary relationship between cobalt-specific and other metal transporters, and how horizontal gene transfer has shaped the distribution and diversity of these transporters .

The regulatory mechanisms controlling cobalt transport in Thermosipho species also require further investigation. Questions about how expression of the cbiM gene is regulated in response to cobalt availability, the role of B12 riboswitches in coordinating transport and biosynthetic pathways, and the mechanisms of post-translational regulation of transport activity remain to be fully addressed .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.