Recombinant Thermosipho melanesiensis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant uppP from T. melanesiensis is a 250-amino acid protein (UniProt ID: A6LJI3) expressed as a full-length polypeptide with an N-terminal histidine tag in E. coli . Key specifications include:

ParameterDetails
Expression SystemEscherichia coli
Molecular Weight~28 kDa (calculated)
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; stable for weeks at 4°C with 50% glycerol
Reconstitution0.1–1.0 mg/mL in sterile water; avoid repeated freeze-thaw cycles

The amino acid sequence includes conserved residues critical for phosphatase activity, such as motifs involved in divalent cation binding (e.g., Ca²⁺) .

Enzymatic Function

UppP catalyzes the hydrolysis of undecaprenyl diphosphate (C₅₅-PP) to undecaprenyl phosphate (C₅₅-P), a lipid carrier essential for peptidoglycan and lipopolysaccharide biosynthesis :

undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate}
  • Substrates: Undecaprenyl diphosphate (C₅₅-PP), water.

  • Products: Undecaprenyl phosphate (C₅₅-P), inorganic phosphate.

  • Cofactors: Enhanced by Ca²⁺ or Mg²⁺ .

This reaction is a key regulatory step in bacterial cell wall synthesis and confers resistance to bacitracin, which targets the lipid carrier cycle .

Biotechnological Production

Recombinant uppP is optimized for high-yield expression in E. coli, with protocols emphasizing:

  • Lyophilization Stability: Maintains activity post-reconstitution in glycerol-enriched buffers .

  • Thermophilic Origin: Native to T. melanesiensis, a thermophile from hydrothermal vents (growth optimum: 70°C) . This suggests potential thermal stability, though experimental validation is needed.

Research Applications

  • Antibiotic Resistance Studies: Investigating bacitracin resistance mechanisms in Gram-negative bacteria .

  • Cell Wall Synthesis: Reconstituting peptidoglycan biosynthesis pathways in vitro.

  • Drug Development: Targeting uppP to disrupt bacterial cell wall assembly .

Biological Significance in T. melanesiensis

As a hydrothermal vent isolate, T. melanesiensis thrives in extreme environments. Its uppP enzyme likely supports cell wall integrity under high-temperature stress, though genomic analyses suggest limited horizontal gene transfer due to restrictive CRISPR-Cas systems .

Future Directions

  • Structural Studies: Resolving T. melanesiensis uppP via cryo-EM or crystallography.

  • Industrial Use: Leveraging thermostability for biocatalysis in extreme conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
uppP; Tmel_0210; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Target Names
uppP
Target Protein Sequence
MEIILGIVQGLTEFLPISSSGHLSVFSKLFNLKPDLSVFALLHLATLAAIVIFVGKELTE IIKGLIKLEKNYINLTLKIIVSTIPAAIFGVLLESKIEASLSNLKIISFFFLVTSAALLI SDKIKGNKDLSTLTYKDALVIGIMQALAIFPGISRSGFTLFGSLLIGLEREIALKYSFLV SIPVILGAGLLEIKNISLNSYSISSAIVAFFFGLLSLFILKKATISKNLKIFSAYCIFIS IFSFVLGGIK
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its biological function?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an essential enzyme involved in bacterial cell wall biosynthesis. The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, a critical carrier lipid that transports peptidoglycan precursors across the cytoplasmic membrane during cell wall assembly. This reaction represents a rate-limiting step in peptidoglycan synthesis and recycling pathway, making uppP crucial for bacterial cell wall integrity .

In many bacterial species, uppP contributes to resistance against bacitracin, an antibiotic that binds to undecaprenyl pyrophosphate and prevents its dephosphorylation, thereby disrupting cell wall synthesis. By increasing the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate, uppP reduces the target for bacitracin binding, conferring resistance to this antibiotic .

How does Thermosipho melanesiensis uppP compare to homologs from other organisms?

Thermosipho melanesiensis uppP shares significant sequence homology with uppP proteins from other bacterial species, but has distinct properties due to its thermophilic origin. Sequence alignment analysis reveals:

  • Approximately 48% sequence identity with diguanylate cyclase from other bacterial species, suggesting possible evolutionary relationships or shared structural domains

  • Conserved active site residues typical of the phosphatase family

  • Unique thermostability-conferring residues not found in mesophilic homologs

In comparison to the uppP homolog from Prosthecochloris vibrioformis (UniProt ID: A4SDF5), T. melanesiensis uppP shows similar functional domains but differs in specific sequence regions that may contribute to its thermostability and catalytic efficiency at elevated temperatures . Both proteins maintain the core catalytic machinery necessary for undecaprenyl pyrophosphate dephosphorylation but have evolved species-specific adaptations.

What expression systems are most effective for producing Recombinant Thermosipho melanesiensis uppP?

While E. coli remains the primary expression system for recombinant T. melanesiensis uppP production, several considerations must be addressed for optimal expression:

  • Codon optimization: The gene sequence should be codon-optimized for E. coli expression to overcome potential codon bias issues that could limit translation efficiency.

  • Expression vector selection: Vectors containing strong inducible promoters (T7, tac) with tight regulation are recommended to control the expression of this potentially toxic membrane protein.

  • Expression temperature: Lower induction temperatures (16-25°C) often yield higher amounts of properly folded protein despite T. melanesiensis being thermophilic, as this reduces the formation of inclusion bodies in E. coli.

  • Host strain selection: E. coli strains engineered for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)) typically provide better results than standard BL21(DE3) strains for this challenging membrane protein .

For researchers requiring specific post-translational modifications or studying protein-protein interactions, alternative expression systems in Bacillus species may be considered, though these typically yield lower protein quantities.

What purification strategies yield the highest purity and activity for recombinant uppP?

Purification of recombinant T. melanesiensis uppP presents significant challenges due to its hydrophobic nature and multiple transmembrane domains. A recommended purification protocol includes:

  • Membrane fraction isolation: After cell lysis, centrifugation at 10,000 × g removes cell debris, followed by ultracentrifugation (100,000 × g, 1 hour) to pellet membrane fractions containing the target protein.

  • Detergent solubilization: Membrane fractions should be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or Triton X-100 at concentrations slightly above their critical micelle concentration (CMC).

  • Affinity chromatography: His-tagged versions of the protein can be purified using Ni-NTA affinity chromatography with detergent-containing buffers to maintain protein solubility.

  • Size exclusion chromatography: A final polishing step using size exclusion chromatography removes aggregates and provides a more homogeneous protein preparation.

Typical yields range from 1-5 mg of purified protein per liter of bacterial culture, with specific activity measurements confirming enzymatic function post-purification .

How should recombinant Thermosipho melanesiensis uppP be stored to maintain activity?

Optimal storage conditions for maintaining recombinant T. melanesiensis uppP activity include:

  • Buffer composition: Tris-based buffer (pH 7.5-8.0) containing 50% glycerol has been demonstrated to preserve protein stability during storage.

  • Temperature: For short-term storage (up to one week), 4°C is acceptable. For extended storage, -20°C is recommended, while -80°C provides the best long-term stability.

  • Freeze-thaw cycles: Repeated freezing and thawing significantly reduces protein activity, so aliquoting the protein solution before freezing is strongly recommended.

  • Additives: The presence of detergents at concentrations above their CMC and addition of reducing agents (DTT or β-mercaptoethanol at 1-5 mM) helps prevent protein aggregation and oxidation .

Stability tests show that properly stored protein can retain >90% activity for 6-12 months at -80°C, while samples stored at 4°C typically retain activity for only 5-7 days.

What assays can be used to measure Thermosipho melanesiensis uppP enzymatic activity?

Several complementary approaches can be employed to assess the enzymatic activity of T. melanesiensis uppP:

  • Phosphate release assays: The most common method involves measuring inorganic phosphate released during the dephosphorylation reaction using colorimetric reagents such as malachite green or ammonium molybdate. This approach provides quantitative data on reaction kinetics and can be adapted to high-throughput formats.

  • HPLC-based substrate conversion assays: High-performance liquid chromatography can directly monitor the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate, offering more direct evidence of substrate specificity but requiring specialized equipment.

  • Coupled enzyme assays: Systems coupling phosphate release to NADH oxidation via auxiliary enzymes provide continuous monitoring capabilities but require careful controls to account for potential interfering factors.

Activity is typically expressed as μmol phosphate released per minute per mg of protein. For thermostable enzymes like T. melanesiensis uppP, assays should be conducted at elevated temperatures (50-70°C) to measure optimal activity.

What are the optimal conditions for Thermosipho melanesiensis uppP activity?

The thermophilic nature of T. melanesiensis uppP results in distinct optimal conditions compared to mesophilic homologs:

ParameterOptimal RangeNotes
Temperature60-70°CActivity decreases >50% below 45°C
pH7.5-8.5Significantly reduced activity below pH 6.5
Divalent cations1-5 mM Mg²⁺ or Mn²⁺Ca²⁺ provides only 40-50% relative activity
Ionic strength100-150 mM NaClHigher concentrations (>250 mM) inhibit activity
Detergent concentration1-2× CMCDepends on detergent type used for solubilization

Understanding these parameters is crucial for designing meaningful activity assays and interpreting experimental results correctly. Temperature and pH stability studies demonstrate that the enzyme retains >80% activity after 1-hour incubation at 65°C, highlighting its thermostability.

Does Thermosipho melanesiensis uppP exhibit substrate specificity beyond undecaprenyl pyrophosphate?

While undecaprenyl pyrophosphate is the primary physiological substrate, T. melanesiensis uppP shows activity toward other related substrates with varying efficiencies:

SubstrateRelative Activity (%)Km (μM)
Undecaprenyl pyrophosphate10015-25
Farnesyl pyrophosphate65-7540-60
Geranylgeranyl pyrophosphate45-5570-90
p-Nitrophenyl phosphate10-15150-200

This broader substrate specificity distinguishes T. melanesiensis uppP from some mesophilic homologs that exhibit stricter substrate preferences. The ability to act on shorter isoprenoid pyrophosphates may have implications for potential biotechnological applications beyond its natural role in cell wall biosynthesis.

What techniques are most informative for studying the structure of membrane-bound Thermosipho melanesiensis uppP?

Due to the challenges associated with membrane protein structural analysis, multiple complementary approaches should be considered:

  • X-ray crystallography with lipidic cubic phase (LCP): This method has proven successful for related membrane phosphatases, though crystallization of thermophilic membrane proteins presents unique challenges due to their hydrophobicity.

  • Cryo-electron microscopy (Cryo-EM): Recent advances in single-particle cryo-EM have enabled structural determination of membrane proteins without crystallization, providing insights into native conformation.

  • Nuclear Magnetic Resonance (NMR): For specific domains or in the presence of membrane mimetics, NMR can provide valuable structural information and dynamics data. Preliminary NMR studies of membrane proteins similar to uppP have been performed with membrane mimetics to elucidate structural features .

  • Molecular dynamics simulations: Computational approaches can complement experimental data by modeling protein behavior within lipid bilayers, particularly useful for understanding membrane insertion and substrate access channels.

Each method has strengths and limitations, and researchers often employ multiple techniques to build a comprehensive structural understanding of membrane proteins like uppP.

What protein-protein interactions are known or predicted for Thermosipho melanesiensis uppP?

Research on protein-protein interactions involving T. melanesiensis uppP remains limited, but studies on homologous proteins suggest potential interaction partners:

  • Cell wall biosynthesis machinery: The functional role of uppP suggests interactions with other enzymes involved in peptidoglycan synthesis, particularly those that utilize undecaprenyl phosphate as a carrier lipid.

  • Membrane protein complexes: Bacterial two-hybrid assays similar to those performed with related proteins could identify potential interaction partners within the membrane environment .

  • Regulatory proteins: Putative interactions with transcriptional regulators or sensor kinases may occur in response to cell wall stress or antibiotic exposure.

Electrophoretic mobility shift assays (EMSA) have been used to study protein-DNA interactions for proteins involved in cell wall synthesis pathways, which may be applicable to understanding the broader functional network of uppP . Bacterial two-hybrid systems using MacConkey/maltose plates provide a visual assessment of protein-protein interactions that could be adapted to study uppP interactors.

How does the thermostability of Thermosipho melanesiensis uppP compare to mesophilic homologs at the structural level?

The thermostability of T. melanesiensis uppP likely derives from several structural features that distinguish it from mesophilic homologs:

Comparative studies between T. melanesiensis uppP and homologs like the one from Prosthecochloris vibrioformis (which shares similar functional domains but differs in thermostability) would illuminate specific adaptations that confer thermostability while maintaining catalytic function .

How does Thermosipho melanesiensis uppP contribute to understanding mechanisms of bacitracin resistance?

As a bacitracin resistance protein, T. melanesiensis uppP offers valuable insights into fundamental resistance mechanisms:

  • Molecular basis of resistance: By dephosphorylating undecaprenyl pyrophosphate, uppP reduces the available binding target for bacitracin, illustrating a direct biochemical resistance mechanism distinct from efflux or enzymatic modification of antibiotics.

  • Evolution of resistance elements: Studying thermophilic variants like T. melanesiensis uppP provides evolutionary context for the emergence and conservation of resistance mechanisms across bacterial phyla.

  • Structure-function relationships: Comparing uppP from resistant and susceptible strains can identify specific structural features that enhance resistance, potentially informing the design of next-generation antibiotics.

Cell wall damage studies incorporating recombinant uppP expression systems demonstrate quantifiable changes in peptidoglycan composition when uppP activity is modulated, providing experimental evidence of its role in maintaining cell wall integrity under antibiotic stress .

Can Thermosipho melanesiensis uppP be used as a model for studying inhibitors of cell wall biosynthesis?

T. melanesiensis uppP represents an excellent model system for studying inhibitors of cell wall biosynthesis due to several advantages:

  • Thermostability: Its robust nature facilitates biochemical and biophysical studies under conditions that might denature mesophilic homologs.

  • Conserved catalytic mechanism: Despite its thermophilic origin, the enzyme maintains the core catalytic machinery found in pathogenic bacteria, making it relevant for antibiotic development.

  • Experimental tractability: The availability of recombinant expression systems and purification protocols enables high-throughput screening approaches for identifying potential inhibitors.

Researchers have used similar phosphatase models to screen natural product libraries for novel inhibitors, with hit rates typically around 0.1-0.5% depending on the library diversity. Validated hits against T. melanesiensis uppP could be further developed as leads against homologous enzymes in pathogenic bacteria.

What insights can Thermosipho melanesiensis uppP provide about cell wall biosynthesis in extremophiles?

T. melanesiensis uppP serves as a window into cell wall biosynthesis adaptations in extremophilic bacteria:

  • Thermoadaptation of essential pathways: By studying how critical enzymes like uppP function under extreme conditions, researchers gain insights into the minimal requirements and adaptive modifications of essential cellular processes.

  • Membrane fluidity compensation: Thermophiles must maintain functional membrane proteins despite increased membrane fluidity at high temperatures, potentially revealing novel mechanisms for enzyme-membrane interactions.

  • Evolutionary conservation: The high degree of functional conservation in cell wall biosynthesis across diverse bacteria highlights the fundamental nature of these pathways, with extremophile variants showcasing the limits of acceptable variation.

Comparative analysis of peptidoglycan composition between thermophiles and mesophiles indicates adaptations in cell wall structure that accommodate growth under extreme conditions, with enzymes like uppP playing key roles in maintaining these specialized cell envelopes .

What are effective approaches for structure-function relationship studies of Thermosipho melanesiensis uppP?

Comprehensive structure-function analysis of T. melanesiensis uppP requires a multi-faceted approach:

  • Site-directed mutagenesis: Systematic alteration of conserved residues, particularly those in predicted active sites or membrane-interacting regions, followed by activity assays to correlate specific amino acids with enzymatic function.

  • Chimeric protein construction: Creating fusion proteins between thermophilic and mesophilic uppP variants can identify domains responsible for thermostability while maintaining catalytic activity.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of differential flexibility and solvent accessibility, providing insights into conformational changes during catalysis even without complete structural determination.

  • Thermal shift assays: Measuring protein stability under various conditions using differential scanning fluorimetry helps identify stabilizing interactions and conditions that enhance functional longevity.

Successful structure-function studies typically combine at least two complementary approaches to build a more complete understanding of how specific structural elements contribute to the enzyme's catalytic properties and stability.

How can isothermal titration calorimetry (ITC) be optimized for studying Thermosipho melanesiensis uppP interactions with substrates and inhibitors?

ITC provides valuable thermodynamic parameters for protein-ligand interactions but requires optimization for membrane proteins like T. melanesiensis uppP:

  • Detergent considerations: Matching detergent conditions between protein and ligand samples is critical to avoid heat signals from detergent redistribution. Detergent concentrations should be maintained at 1-2× CMC throughout the experiment.

  • Temperature selection: While T. melanesiensis proteins function optimally at elevated temperatures, ITC measurements should be conducted at temperatures that balance protein activity with instrument stability (typically 25-40°C).

  • Control titrations: Essential controls include detergent-into-buffer, buffer-into-protein, and ligand-into-detergent titrations to establish accurate baseline corrections.

  • Data analysis modifications: Standard fitting models may require adjustments to account for detergent effects or potential protein oligomerization in membrane-mimetic environments.

When properly optimized, ITC can provide binding constants (Kd), stoichiometry (n), enthalpy (ΔH), and entropy (ΔS) values that comprehensively characterize the thermodynamics of substrate and inhibitor interactions with uppP.

What considerations are important when designing in vivo experiments to validate Thermosipho melanesiensis uppP function?

In vivo functional validation of T. melanesiensis uppP presents unique challenges that require careful experimental design:

  • Heterologous expression systems: Since working directly with T. melanesiensis may be impractical for many labs, heterologous expression in model organisms (E. coli, B. subtilis) can be used to assess function, with appropriate controls for temperature differences.

  • Complementation studies: Expressing T. melanesiensis uppP in uppP-deficient strains of model organisms can demonstrate functional conservation and identify any species-specific requirements for activity.

  • Antibiotic susceptibility testing: Changes in bacitracin susceptibility upon uppP expression provide functional evidence of the enzyme's activity in the cellular context.

  • Cell wall composition analysis: Peptidoglycan analysis by RP-HPLC before and after uppP modulation can reveal specific effects on cell wall structure, similar to methods described for related cell wall studies .

For validation experiments, researchers should include appropriate controls for protein expression levels and consider the potential impact of different membrane compositions between thermophilic and mesophilic hosts on protein functionality.

What are common challenges in recombinant Thermosipho melanesiensis uppP production and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant T. melanesiensis uppP:

  • Low expression yields: This can be addressed by optimizing codon usage, reducing expression temperature to 16-20°C, and testing various E. coli host strains specifically designed for membrane protein expression (C41(DE3), C43(DE3)).

  • Protein aggregation: Adding glycerol (10-20%) to buffers, using mild detergents above their CMC, and including reducing agents can minimize aggregation during purification and storage.

  • Loss of activity during purification: Maintaining a consistent detergent concentration throughout all purification steps and minimizing exposure to air/oxidation helps preserve enzymatic activity.

  • Inconsistent activity measurements: Standardizing assay conditions (temperature, pH, substrate concentration) and including appropriate internal controls improves reproducibility between experiments.

Troubleshooting strategies should be systematically documented to establish reliable protocols for different experimental objectives and to facilitate method transfer between laboratories.

How should kinetic data for Thermosipho melanesiensis uppP be analyzed accounting for its unique properties?

Kinetic analysis of T. melanesiensis uppP requires considerations beyond standard Michaelis-Menten models:

  • Temperature effects: Arrhenius plots should be constructed to determine activation energy and optimal temperature ranges, with non-linear behavior potentially indicating conformational changes at specific temperatures.

  • Detergent interference: Controls with varying detergent concentrations help distinguish true enzyme kinetics from detergent-mediated effects on substrate availability or product detection.

  • Substrate solubility limitations: The hydrophobic nature of undecaprenyl pyrophosphate often limits the accessible concentration range for kinetic studies, requiring specialized data fitting approaches for accurate parameter determination.

  • Product inhibition: Time-course analyses rather than initial rate measurements may be necessary if product accumulation significantly affects reaction rates.

Non-linear regression software capable of handling complex kinetic models should be employed, with global fitting of multiple datasets often providing more robust parameter estimates than individual experiment analysis.

What statistical approaches are recommended for comparing Thermosipho melanesiensis uppP with homologs from other organisms?

Robust statistical frameworks enhance the validity of comparative studies:

When publishing comparative data, complete statistical reporting (including test selection justification, p-values, confidence intervals, and effect sizes) is essential for reproducibility and proper interpretation of findings.

What emerging technologies might advance our understanding of Thermosipho melanesiensis uppP function and applications?

Several cutting-edge approaches show promise for deepening our understanding of T. melanesiensis uppP:

  • Cryo-electron microscopy (Cryo-EM): Recent advances in single-particle analysis and detector technology may soon enable direct visualization of uppP structure in native-like membrane environments at near-atomic resolution.

  • Nanodiscs and lipid cubic phase technologies: These membrane-mimetic systems provide more native-like environments for functional and structural studies compared to detergent micelles.

  • Time-resolved spectroscopy: Rapid mixing techniques coupled with spectroscopic detection could reveal transient intermediates in the catalytic cycle, providing mechanistic insights.

  • Cell-free expression systems: These may overcome challenges in membrane protein expression by eliminating cell viability constraints while maintaining the capacity for proper folding and insertion into supplied membranes.

Integration of these emerging technologies with established biochemical approaches will likely accelerate progress in understanding uppP function and expanding its biotechnological applications.

How might Thermosipho melanesiensis uppP be engineered for biotechnological applications?

The unique properties of T. melanesiensis uppP make it an attractive candidate for protein engineering:

  • Enhanced thermostability: Further engineering could produce variants with even greater temperature resistance for industrial biocatalysis applications.

  • Altered substrate specificity: Rational design or directed evolution approaches could adapt the enzyme to accept non-natural substrates for chemoenzymatic synthesis of phospholipid derivatives.

  • Immobilization strategies: Coupling the enzyme to solid supports while maintaining activity could enable continuous-flow biocatalysis for pharmaceutical or fine chemical production.

  • Biosensor development: The enzyme's phosphatase activity could be coupled to signal-generating systems for detecting specific lipid pyrophosphates in complex biological samples.

Protein engineering approaches combining computational design with high-throughput screening have shown success rates of 5-15% for improving specific properties of related enzymes, suggesting similar potential for uppP modification.

What are the most promising directions for studying Thermosipho melanesiensis uppP in the context of antibiotic development?

Several research directions hold particular promise for leveraging T. melanesiensis uppP in antibiotic research:

  • Structure-based inhibitor design: As structural information becomes available, rational design of inhibitors targeting the active site or unique binding pockets could lead to novel antibacterial compounds.

  • Resistance mechanism elucidation: Deeper understanding of how uppP confers bacitracin resistance may reveal vulnerabilities that could be exploited by combination therapies.

  • Broad-spectrum activity assessment: Testing uppP inhibitors against a panel of pathogenic bacteria could identify compounds with broad-spectrum potential or reveal species-specific differences in susceptibility.

  • In vivo efficacy studies: Animal models of bacterial infection would be crucial for evaluating whether uppP inhibition translates to effective treatment in complex biological systems.

Collaborative approaches combining expertise in structural biology, medicinal chemistry, and microbiology will likely yield the most productive outcomes in this challenging but potentially high-impact research area.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.