Recombinant Thermosynechococcus elongatus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
petA; tlr0960; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-311
Protein Length
Full Length of Mature Protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
petA
Target Protein Sequence
YPFYAQQGYESPREATGRIVCANCHLAAKPIQVEVPQAVTPDSVFEAVVKIPYDTSVQQV LGDGSKGGLNVGAVLMLPEGFKIAPPDRLPEELQAKTSGIYYQPYSDDQQNIILVGPLPG EQYQEIVFPILAPNPGTDKSIHFGKYAVHAGGNRGRGQVYPNGEKSNNNVFTAPIAGTIT SITPNPDGSTAVVITPENGEAVTETVPAGPELIVREGQTVVAGAALTNNPNVGGFGQKDT EIVLQDPNRIKWLLVFFAAITLSQILLVLKKKQVEKVQAAEMSF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: tel:tlr0960

STRING: 197221.tlr0960

Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is Thermosynechococcus elongatus and why is it significant for recombinant protein studies?

Thermosynechococcus elongatus BP1 is a thermophilic strain of cyanobacteria with an optimum growth temperature of 57°C. It was originally isolated from hot springs in Japan and cannot survive at temperatures below 30°C, making it a useful model for biocontainment studies . Its thermophilic nature also presents unique advantages for protein expression studies, as proteins from this organism often exhibit enhanced stability. The strain's complete genome has been sequenced (approximately 2.6 Mbp circular genome), and it is naturally transformable, facilitating genetic manipulation for recombinant studies . These characteristics make T. elongatus particularly valuable for studying thermostable variants of photosynthetic proteins like Apocytochrome f.

What is Apocytochrome f (petA) and what role does it play in electron transport?

Apocytochrome f is the precursor form of cytochrome f, a crucial component of the cytochrome b6f complex that facilitates electron transfer in the photosynthetic electron transport chain. The petA gene encodes this protein, which undergoes post-translational modification including heme attachment to form mature cytochrome f.

In photosynthetic organisms like T. elongatus, cytochrome f mediates electron transfer between Photosystem II and Photosystem I by interacting with mobile electron carriers such as plastocyanin or cytochrome c6. Based on studies of cytochrome f from other organisms, we know that it contains specific structural domains that facilitate these interactions, including a small domain with flexible loops that influence binding kinetics with electron transfer partners . The specific structural features of T. elongatus cytochrome f adapted to high-temperature environments make it particularly interesting for structure-function relationship studies.

How do optimal growth conditions for T. elongatus affect recombinant protein expression?

T. elongatus requires specific growth conditions that directly impact recombinant protein expression:

ParameterOptimal ConditionEffect on Protein Expression
Temperature45-57°CHigher temperatures (up to optimal) increase expression rates but may affect protein folding
LightModerate to high intensityAffects photosynthetic rate and energy availability for protein synthesis
pH7.5-8.0Influences cellular metabolism and protein stability
MediaBG-11 with possible modificationsNutrient availability affects growth rate and expression levels

The thermophilic nature of T. elongatus means that standard protein expression protocols must be modified to accommodate high-temperature cultivation. Growth phase also significantly affects cellular physiology - the strain maintains 3-4 genome copies during lag phase, early growth phase, or stationary phase, but shows increased ploidy (5.5 ± 0.3 copies) during exponential phase . These ploidy changes may impact recombinant gene expression levels throughout the growth cycle.

What genetic transformation methods work effectively with T. elongatus?

T. elongatus is naturally transformable, which simplifies genetic engineering approaches. Effective transformation methods include:

  • Natural transformation with homologous recombination: DNA constructs with homology arms targeting the desired integration site can be directly added to competent cells.

  • Integrative transformation: As demonstrated in previous studies, constructs like pKA and YFP-ST-R-Lipase can be introduced through homologous recombination into specific genome positions .

  • Selection strategies: Antibiotic resistance markers (such as tetracycline resistance) have been successfully used for selecting transformants .

When transforming T. elongatus, researchers must consider its polyploid nature, as complete segregation of mutations across all genome copies is necessary to achieve a homogeneous genotype. Additionally, the thermophilic nature of T. elongatus requires thermostable selectable markers for efficient selection at elevated growth temperatures.

How does genome ploidy in T. elongatus affect recombinant petA expression and segregation?

T. elongatus exhibits growth phase-dependent ploidy levels that significantly impact recombinant gene expression and segregation:

  • Ploidy fluctuates from 3-4 genome copies in lag and stationary phases to approximately 5.5 copies during exponential growth .

  • Growth conditions further influence ploidy - high phosphate (6.9 ± 0.2 copies) and bicarbonate (7.6 ± 0.7 copies) supplementation increase average genome copy number .

  • Temperature and antibiotic stress reduce the percentage of cells with lower ploidy (mono-, di-, and triploid cells) while maintaining average ploidy levels across the population .

These ploidy dynamics present specific challenges for petA modification:

  • Multiple genome copies require multiple rounds of selection to achieve homoplasmy

  • Expression levels may vary depending on the number of modified copies

  • Growth phase-dependent ploidy fluctuations may cause inconsistent expression patterns

Research suggests that limiting phosphate availability increases the proportion of mono- and diploid cells, which could facilitate more efficient generation of genetically engineered T. elongatus strains with modifications to the petA gene . This approach could reduce the time needed to achieve homoplasmic transformants when introducing recombinant Apocytochrome f variants.

What structural adaptations enable T. elongatus Apocytochrome f to function at high temperatures?

The thermostable nature of T. elongatus Apocytochrome f involves several structural adaptations compared to mesophilic counterparts:

  • Increased hydrophobic core packing

  • Higher proportion of charged amino acids forming ionic networks

  • Reduced number of thermolabile residues

  • Enhanced secondary structure stabilization through additional hydrogen bonding

For recombinant studies, understanding these thermophilic adaptations is crucial when designing modifications that preserve thermostability while altering specific functional properties.

How do environmental stressors affect recombinant Apocytochrome f expression and stability?

Environmental stressors significantly influence both expression and stability of recombinant proteins in T. elongatus:

StressorEffect on ExpressionEffect on StabilityResearch Implications
Temperature variationAltered expression rate; changes in ploidyPotential misfolding at suboptimal temperaturesRequires precise temperature control during experiments
Nutrient limitationModified expression levelsMinimal direct effectCan be used strategically to control ploidy
Light intensityChanges in photosynthetic capacity affect energy availabilityPotential photooxidative damageNecessitates optimized illumination protocols
Antibiotic stressAltered ploidy distribution Potential impact on protein processingImportant consideration for selection strategies

T. elongatus demonstrates specific stress responses that differ from mesophilic cyanobacteria, including increased expression of heat shock proteins and altered RNA polymerase activity at elevated temperatures . These responses must be considered when analyzing recombinant protein expression under various experimental conditions.

What methodological approaches can resolve protein-protein interaction dynamics of modified cytochrome f?

Brownian dynamics simulations have proven valuable for studying cytochrome f interactions with electron transfer partners. These computational approaches can reveal how even small structural differences affect reaction rates and binding kinetics . When applied to T. elongatus cytochrome f:

  • Simulation parameters must account for the thermophilic environment

  • Domain-specific interactions can be assessed by modeling with and without specific structural elements

  • Electrostatic interactions (particularly involving charged residues on flexible loops) significantly influence partner binding and can be computationally predicted

These computational approaches, combined with experimental techniques like isothermal titration calorimetry and surface plasmon resonance, provide comprehensive insights into how structural modifications to recombinant cytochrome f affect interaction dynamics with electron transfer partners.

What critical controls are necessary when studying recombinant T. elongatus Apocytochrome f?

When designing experiments with recombinant T. elongatus Apocytochrome f, the following controls are essential:

  • Wild-type T. elongatus strains maintained under identical conditions to isolate the effects of genetic modifications

  • Temperature controls to distinguish between temperature-dependent effects and those directly attributable to recombinant protein function

  • Growth phase-matched samples to account for ploidy-related variations in expression

  • Domain deletion/mutation controls to establish structure-function relationships, similar to approaches used in cytochrome f studies from other species

  • Electron transfer partner controls (e.g., wild-type and modified plastocyanin or cytochrome c6) to fully characterize interaction dynamics

When interpreting experimental data, researchers should consider the natural thermophilic adaptations of T. elongatus and how these might influence the behavior of recombinant proteins compared to orthologues from mesophilic organisms.

How can researchers optimize transformation efficiency for petA modifications in T. elongatus?

Optimizing transformation efficiency for petA modifications requires specific strategies tailored to T. elongatus:

  • Strategic timing: Transform during early growth phase when cells are most competent while maintaining manageable ploidy levels (3-4 copies)

  • Phosphate limitation: Culture cells under reduced phosphate conditions before transformation to increase the proportion of cells with lower ploidy levels, facilitating more efficient segregation of modified genomes

  • Homology arm design: Use extended homology arms (>500 bp) flanking the petA gene to enhance recombination efficiency

  • Temperature cycling: Apply controlled temperature fluctuations during selection to stress cells while maintaining viability, potentially accelerating segregation

  • Selection pressure optimization: Determine the minimum inhibitory concentration of antibiotics at elevated temperatures and use concentrations that allow growth of true transformants while preventing background growth

These approaches can significantly improve both initial transformation efficiency and subsequent segregation to homoplasmy, reducing the time required to obtain stable recombinant lines.

What purification strategies are most effective for isolating recombinant Apocytochrome f from T. elongatus?

Purifying recombinant Apocytochrome f from T. elongatus requires specialized approaches that account for its thermophilic origin and membrane association:

  • Cell disruption: Optimized sonication or high-pressure homogenization at elevated temperatures (30-40°C) to maintain protein stability while disrupting thermostable cell walls

  • Differential solubilization: Selective membrane solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin) that preserve protein structure

  • Heat treatment: Exploiting the thermostability of T. elongatus proteins by heating lysates (50-55°C) to precipitate contaminating mesophilic proteins from expression systems

  • Chromatography sequence:

    • Ion exchange chromatography (typically anion exchange at pH 8.0)

    • Hydrophobic interaction chromatography

    • Size exclusion as a final polishing step

  • Affinity tags: If incorporated into the recombinant design, histidine or strep tags enable affinity chromatography while minimizing structural disruption

These purification approaches should be optimized based on the specific modifications made to Apocytochrome f and the experimental requirements for downstream applications.

How can researchers distinguish between endogenous and recombinant Apocytochrome f in experimental systems?

Distinguishing between endogenous and recombinant Apocytochrome f requires specific experimental strategies:

  • Epitope tagging: Incorporation of small epitope tags (FLAG, HA, etc.) that minimally impact protein function but enable specific detection

  • Spectroscopic analysis: Engineered spectral shifts through specific amino acid substitutions near the heme environment

  • Immunological detection: Development of antibodies against unique epitopes present only in the modified protein

  • Mass spectrometry: Detection of specific mass shifts resulting from amino acid substitutions or additions

  • Functional assays: Engineered changes in redox potential or electron transfer kinetics that create distinguishable functional characteristics

Researchers must carefully validate that their detection methods do not themselves alter the properties being studied, particularly when investigating subtle structure-function relationships in electron transfer processes.

How should researchers account for temperature effects when comparing cytochrome f studies across species?

When comparing cytochrome f studies across thermophilic and mesophilic species, researchers must implement specific analytical approaches:

  • Temperature normalization: Develop mathematical models that normalize reaction rates and binding constants relative to each organism's optimal growth temperature

  • Reduced temperature coefficients: Calculate Q10 values (rate change per 10°C) for specific reactions to quantify temperature sensitivity differences

  • Equivalent state principle: Compare proteins at temperatures that represent equivalent physiological states rather than absolute temperatures

  • Structural flexibility analysis: Quantify and account for differences in structural dynamics at respective physiological temperatures

  • Computational validation: Use molecular dynamics simulations at appropriate temperatures to predict and interpret experimental observations

These approaches enable meaningful comparisons between thermophilic T. elongatus cytochrome f and mesophilic counterparts, allowing researchers to distinguish temperature-dependent effects from intrinsic structural and functional differences.

What approaches can resolve contradictory findings in Apocytochrome f structure-function studies?

Resolving contradictions in structure-function studies requires systematic analytical approaches:

  • Experimental condition mapping: Create comprehensive matrices of experimental conditions across contradictory studies to identify key variables

  • Sequential parameter isolation: Systematically vary individual parameters while holding others constant to identify specific sources of discrepancy

  • Multi-method validation: Apply complementary experimental techniques (spectroscopy, crystallography, NMR, computational modeling) to verify structural interpretations

  • Ploidy consideration: Assess whether contradictory results correlate with different ploidy states in the experimental systems

  • Domain-specific analysis: Isolate effects of specific domains (e.g., small domain flexible loops) that might disproportionately influence results under different conditions

How does the thermophilic biosafety feature of T. elongatus impact experimental design and data interpretation?

The inability of T. elongatus to survive below 30°C serves as a natural biosafety feature with important implications for experimental design :

  • Containment validation: Researchers should verify that their specific recombinant strains maintain temperature-dependent viability patterns similar to wild-type

  • Survival kinetics assessment: Data from temperature-sensitivity studies suggest differences between wild-type and GE strains, with GE strains showing complete death after 2 weeks at cool temperatures (15.44°C-25.30°C) while wild-type required 2-4 weeks

  • Transportation considerations: Samples must be maintained at appropriate temperatures during transfer between facilities

  • Risk assessment modification: Experimental design should incorporate specific controls to evaluate whether genetic modifications alter the inherent temperature sensitivity

  • Warm temperature limitations: Research indicates that at temperatures between 31.42°C-36.27°C, growth is hindered but cells remain viable for 2-4 weeks , necessitating careful interpretation of long-term experiments conducted at these borderline temperatures

These considerations ensure both experimental reproducibility and appropriate biosafety when working with recombinant T. elongatus strains.

What statistical approaches best address the heterogeneity in gene copy number when analyzing recombinant protein expression?

The polyploid nature of T. elongatus introduces specific statistical challenges when analyzing recombinant protein expression:

  • Population distribution analysis: Flow cytometry or single-cell analysis to characterize the distribution of genome copies across the experimental population

  • Weighted expression models: Mathematical frameworks that account for the proportion of cells with different ploidy levels when interpreting bulk expression data

  • Growth phase stratification: Statistical analyses that separate data by growth phase to control for natural ploidy variations

  • Multivariate analysis: Techniques that simultaneously evaluate the effects of temperature, nutrients, growth phase, and ploidy on expression levels

  • Bayesian approaches: Models that incorporate prior knowledge about ploidy-expression relationships to strengthen inferences from limited experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.