Recombinant Thermosynechococcus elongatus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Thermosynechococcus elongatus ATP synthase subunit b (atpF)

Thermosynechococcus elongatus ATP synthase subunit b (atpF) is a component of the ATP synthase complex found in the cyanobacterium Thermosynechococcus elongatus . ATP synthase, also known as F0F1-ATPase, is a crucial enzyme complex that synthesizes adenosine triphosphate (ATP), the primary energy currency of cells . The F1 portion of ATP synthase is responsible for ATP hydrolysis and synthesis, while the F0 portion is embedded in the membrane and facilitates proton transport . Subunit b, along with other subunits, forms the peripheral stalk of the F1F0 ATP synthase, which is essential for binding F1 to F0 and for proper energy transfer between the two sectors of the enzyme .

Role of Subunit b in ATP Synthase

The subunit b is a component of the peripheral stalk of the F1F0 ATP synthase . In E. coli, the peripheral stalk contains b subunits, but photosynthetic organisms like Thermosynechococcus elongatus have two b-like subunits, b and b′, which are believed to form heterodimeric peripheral stalks in F1F0 ATP synthase . Researchers have created chimeric b subunits by replacing parts of the E. coli b subunit with homologous regions from Thermosynechococcus elongatus b and b′ subunits. These chimeric subunits were able to form heterodimeric peripheral stalks and incorporate into functional F1F0 ATP synthase complexes .

Importance of ATP Synthase in Cyanobacteria

ATP synthase plays a vital role in the stress acclimation of cyanobacteria . A study on Synechococcus elongatus UTEX 2973 revealed that a single point mutation in the α subunit of F0F1 ATP synthase (AtpA) significantly improves tolerance to high light and high temperature . This mutation increases AtpA protein levels, intracellular ATP synthase activity, and ATP concentrations under heat stress, as well as photosystem II activity . This highlights the importance of ATP synthase as a target for enhancing stress tolerance in cyanobacteria through metabolic engineering .

Structure and Function of Cyanobacterial F1-ATPase

The F1-ATPase is a segment of the F0F1-ATP synthase, essential for ATP hydrolysis and synthesis . The crystal structure of the central F1 subcomplex, which includes the γ subunit and the inhibitory ε subunit, has been determined in Thermosynechococcus elongatus BP-1 at 1.98 Å resolution . Unlike bacterial and mitochondrial counterparts, the γ subunits of photosynthetic organisms have a unique insertion of 35–40 amino acids, forming a β-hairpin structure along the central stalk . This β-hairpin structure is critical for inhibiting ATP hydrolysis, and its truncation impairs the interaction with the ε subunit .

AtpΘ: An Inhibitor of ATP Synthase

AtpΘ is a small protein that interacts with the ATP synthase complex and is suggested to be a functional analog in cyanobacteria to the inhibitory peptides that prevent ATP synthase from running backwards in mitochondria . Studies have shown that AtpΘ associates with thylakoid membranes and interacts directly with ATP-synthase subunits . In Thermosynechococcus elongatus BP-1, a predicted AtpΘ homolog functions similarly to AtpΘ of Synechocystis 6803, where membrane samples from light-cultivated cells showed higher ATPase activities than those from dark-incubated cells .

Impact of Mutations on ATP Synthase Activity

StrainConditionAtpA LevelsF0F1 ATPase Synthase ActivityIntracellular ATP Concentration
Sye7942Heat StressElevatedDecreased-
Sye7942-C252YNormalHigherHigher-
Sye7942-C252YHeat StressHigherHigherHigher
Sye2973NormalHigherHigher-
Sye2973High Light/Temp--More

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; tlr0433; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
atpF
Target Protein Sequence
MSVMDALFLLATEEVGHFGINTNLLETNVINLAILIGVLVYFGRGVLGKTLGDRQKQIAT AIAEAEERQKVAAARLAEAQQKLTQAKQEAQRIREDALTRAKAVKEEIIAQAKREIERLQ ETASQDTSAATERAIAEIRERIAAMALAEAENQLKARLSQNPDLQRTLIDRSIALLGGK
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk, connecting F(1) and F(0). The Thermosynechococcus elongatus complex exhibits exceptional stability, retaining functionality even after 6 hours at 55°C.

Database Links

KEGG: tel:tlr0433

STRING: 197221.tlr0433

Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

Why is Thermosynechococcus elongatus ATP synthase particularly important for research?

T. elongatus ATP synthase possesses several distinctive properties that make it valuable for research:

  • Exceptional thermal stability: The ATP synthase from T. elongatus remains functional at temperatures up to 95°C, with optimal activity at its natural growth temperature of 55°C .

  • Resistance to chaotropic agents: Unlike other ATP synthases that can be disassembled with Coomassie dye, T. elongatus ATP synthase shows remarkable stability against chaotropic reagents such as sodium bromide and guanidine thiocyanate .

  • Unique regulatory mechanisms: T. elongatus possesses regulatory proteins like AtpΘ (AtpQ) that prevent futile ATP hydrolysis under unfavorable conditions, offering insights into energy conservation mechanisms in thermophilic environments .

  • Model system for photosynthetic organisms: As a thermophilic cyanobacterium with both photosynthetic and respiratory electron transfer systems in the same membrane, T. elongatus provides a unique model for studying energy conversion processes .

These properties make T. elongatus ATP synthase an excellent model for studying structure-function relationships, thermal adaptation of proteins, and the evolution of energy conversion mechanisms .

How does the b subunit (atpF) differ between cyanobacteria and other organisms?

The b subunit (atpF) in cyanobacteria exhibits several distinctive features compared to other organisms:

  • Subunit duplication: Cyanobacteria possess two types of b subunits (b and b'), whereas most bacteria have only one type. The subunit composition in cyanobacteria is represented as the peripheral stalk consisting of (AtpF2)(AtpF), where AtpF2 is the b' subunit and AtpF is the b subunit .

  • Structural adaptations: In thermophilic cyanobacteria like T. elongatus, the b subunit shows specific adaptations for thermostability, including altered amino acid composition and stronger ionic interactions .

  • Interaction with regulatory proteins: The b subunit in cyanobacteria interacts with specific regulatory proteins such as AtpΘ that are not found in most other organisms .

  • Membrane association: Due to the unique arrangement of both photosynthetic and respiratory complexes in the same thylakoid membrane, the cyanobacterial b subunit has evolved specific features for integration into this complex membrane system .

These differences reflect the evolutionary adaptations of cyanobacteria to their specific ecological niches and energy metabolism requirements .

What are the optimal methods for recombinant expression and purification of T. elongatus atpF?

Based on published methodologies, the following approaches have proven effective for recombinant expression and purification of T. elongatus atpF:

Expression System Selection:

  • E. coli BL21(DE3) with pET-based vectors has been successfully used, particularly with a mild induction (0.1-0.5 mM IPTG) at lower temperatures (18-25°C) to improve protein folding.

  • Alternatively, cyanobacterial expression hosts like Synechocystis sp. PCC 6803 may provide better folding environments for membrane proteins .

Purification Strategy:

  • Initial Extraction: For the ATP synthase complex from T. elongatus, a combination of dye-ligand chromatography and anion exchange chromatography has been necessary to yield highly pure preparations due to the high content of phycobilisomes .

  • Chromatography Steps:

    • Dye-ligand chromatography (often using Reactive Red or Cibacron Blue)

    • Anion exchange chromatography (Q-Sepharose or similar matrix)

    • Optional size exclusion chromatography for final polishing

  • Buffer Considerations:

    • Use of detergents appropriate for membrane proteins (e.g., n-dodecyl-β-D-maltoside)

    • Inclusion of stabilizing agents (glycerol 10-20%)

    • Consideration of higher temperatures during purification steps to match native conditions

  • Verification Methods:

    • SDS-PAGE analysis

    • Mass spectrometry for subunit identification

    • Western blotting with specific antibodies

When working with the isolated b subunit (atpF), additional considerations include the use of chaotropic agents for initial solubilization, followed by refolding protocols if necessary .

How can researchers assess the functional integrity of recombinant T. elongatus atpF?

Assessing the functional integrity of recombinant T. elongatus atpF involves several complementary approaches:

1. Structural Analysis:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Limited proteolysis to evaluate correct folding

  • Thermal shift assays to determine stability parameters

2. Integration into the ATP Synthase Complex:

  • Co-immunoprecipitation assays with other ATP synthase subunits

  • Blue native PAGE to assess complex formation

  • Cross-linking studies to evaluate protein-protein interactions

3. Functional Reconstitution:

  • Reconstitution into liposomes to create proteoliposomes

  • ATP synthesis assays using artificially generated proton gradients

  • ATP hydrolysis assays with intact membranes or reconstituted systems

4. Temperature-Dependent Activity:

  • Activity measurements across a temperature range (25-95°C)

  • Stability tests at elevated temperatures

  • Comparison with wild-type enzyme activity profiles

A comprehensive experimental approach published for T. elongatus ATP synthase demonstrated functional integrity through:

  • ATP synthesis energized by an applied electrochemical proton gradient after reconstitution into liposomes

  • Measurement of ATP synthesis rates at different temperatures (showing optimal activity at 55°C, the natural growth temperature)

  • Verification of activity even at extreme temperatures (95°C)

What techniques are most effective for studying atpF interactions with other ATP synthase subunits?

Several techniques have proven effective for studying the interactions between atpF and other ATP synthase subunits:

1. Protein-Protein Interaction Assays:

  • Coimmunoprecipitation (Co-IP): FLAG-tagged atpF or other subunits can be used to pull down interacting partners. This approach successfully identified interactions between AtpΘ (a regulatory protein) and ATP synthase components in cyanobacteria .

  • Cross-linking coupled with mass spectrometry: This approach can identify interaction surfaces and proximity relationships between subunits.

  • Yeast two-hybrid or bacterial two-hybrid systems: These can be adapted for membrane protein studies using appropriate modifications.

2. Structural Biology Approaches:

  • Cryo-electron microscopy: Particularly effective for large complexes like ATP synthase.

  • X-ray crystallography: More challenging but can provide atomic-level details of interactions.

  • NMR spectroscopy: Useful for studying dynamic interactions of smaller domains.

3. Biophysical Methods:

  • Surface plasmon resonance (SPR): Can measure binding kinetics and affinities.

  • Isothermal titration calorimetry (ITC): Provides thermodynamic parameters of interactions.

  • Fluorescence resonance energy transfer (FRET): Useful for studying proximity and conformational changes.

4. Biochemical Approaches:

  • Blue native PAGE: Can separate intact complexes and subcomplexes.

  • Sucrose gradient ultracentrifugation: Helps identify stable complexes.

  • Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS): Provides information on complex stoichiometry.

Research with T. elongatus has shown that Western blotting is particularly useful for detecting stable interactions, such as the SDS-stable oligomer of subunits c . Additionally, mass spectrometry following coimmunoprecipitation has successfully identified all nine single F1FO subunits in T. elongatus .

What is the role of atpF in the context of the ATP synthase regulatory mechanism involving AtpΘ/AtpQ?

The ATP synthase b subunit (atpF) plays a significant role in the regulatory mechanism involving AtpΘ/AtpQ, which is a small amphipathic protein that inhibits ATP hydrolysis under unfavorable conditions in cyanobacteria:

Structural Context:
The peripheral stalk of ATP synthase, which includes atpF (subunit b) and atpF2 (subunit b'), provides a potential binding site for regulatory proteins. AtpΘ has been shown to associate with thylakoid membranes and interact with the ATP synthase complex .

Interaction Evidence:
Coimmunoprecipitation experiments followed by mass spectrometry have demonstrated that AtpΘ (AtpQ) physically interacts with components of the ATP synthase complex. Western blot analysis has confirmed the specific enrichment of ATP synthase subunits, including AtpB (β subunit), in pull-down experiments with FLAG-tagged AtpΘ .

Functional Relationship:

  • Inhibition Mechanism: AtpΘ prevents futile ATP hydrolysis during low-energy conditions (such as darkness). The b subunit (atpF) likely serves as part of the binding platform or contributes to the conformational changes necessary for this regulation .

  • Condition-Dependent Regulation: Experimental data shows that:

    • ATP hydrolysis activity is higher in light-cultivated cells compared to dark-incubated cells in wild-type cyanobacteria

    • This difference is lost in AtpΘ knockout strains

    • Similar regulatory patterns are observed in both Synechocystis 6803 and Thermosynechococcus elongatus BP-1

  • Synthetic Peptide Studies: A synthetic AtpΘ peptide reduces ATPase activity in a dose-dependent manner, with saturation at 20 nmol, further supporting its direct regulatory role in association with the ATP synthase complex, which includes atpF .

This regulatory system involving atpF and AtpΘ appears to be a cyanobacterial adaptation to manage energy conservation, particularly important given that cyanobacteria have both photosynthetic and respiratory electron transport chains in the same membrane system .

How can researchers investigate the structure-function relationship of mutations in T. elongatus atpF?

Investigating structure-function relationships of mutations in T. elongatus atpF requires a comprehensive approach combining molecular, biochemical, and biophysical techniques:

1. Rational Mutation Design:

  • Sequence-based approaches:

    • Multiple sequence alignment of atpF from different thermophilic and mesophilic organisms to identify conserved and variable regions

    • Computational prediction of critical residues using tools like ConSurf or EVcouplings

    • Targeting residues with potential roles in thermostability or protein-protein interactions

  • Structure-based approaches:

    • Using available structural data or homology models to identify:

      • Interface residues with other subunits

      • Residues involved in salt bridges or hydrophobic interactions

      • Regions contributing to peripheral stalk flexibility/rigidity

2. Mutation Generation and Expression:

  • Site-directed mutagenesis techniques

  • Recombinant expression in heterologous systems (E. coli)

  • Development of complementation systems in cyanobacterial mutants

3. Functional Analysis of Mutants:

Analysis TypeTechniqueParameter MeasuredExpected Outcomes
Thermal stabilityDifferential scanning calorimetryMelting temperature (Tm)Changes in thermal denaturation profile
Protein-protein interactionsCo-immunoprecipitationBinding affinity to other subunitsAltered complex formation
ATP synthesis activityReconstituted liposomes with pH gradientATP synthesis rateChanges in catalytic efficiency
ATP hydrolysisEnzymatic assayATPase activityAltered hydrolysis rates or regulation
Temperature dependenceActivity assays at various temperaturesActivity vs. temperature curveShifts in temperature optima

4. Advanced Structural Analysis:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

  • Cryo-EM of assembled complexes with mutant subunits

  • Molecular dynamics simulations to understand the impact of mutations on protein flexibility and stability

5. Comparative Analysis:
Research has shown that SNPs in ATP synthase can significantly impact cellular functions. For example, a comparison between Synechococcus 7942 and Synechococcus 2973 revealed that differences in ATP synthase alleles led to different ATP synthesis rates (773 nmol·min⁻¹·mg Chl⁻¹ vs. 1196 nmol·min⁻¹·mg Chl⁻¹) when placed under the same proton motive force . Similar comparative approaches could be applied to T. elongatus atpF mutants.

By systematically applying these approaches, researchers can establish causative relationships between specific structural features of atpF and its functional properties, particularly those related to thermostability and interaction with regulatory elements .

How does the atpF structure and function in T. elongatus compare to other cyanobacteria?

The atpF structure and function in Thermosynechococcus elongatus exhibits both conserved features and specialized adaptations when compared to other cyanobacteria:

Conserved Features:

  • Regulatory Mechanisms: Both T. elongatus and other cyanobacteria like Synechocystis sp. PCC 6803 utilize AtpΘ (AtpQ) as an inhibitor to prevent futile ATP hydrolysis under unfavorable conditions. This mechanism appears to be conserved across cyanobacterial lineages .

  • Basic Function: In all cyanobacteria, atpF serves as part of the peripheral stalk connecting the F1 and Fo domains of ATP synthase, contributing to the structural stability of the complex .

Specialized Adaptations in T. elongatus:

  • Thermostability: The most significant difference is the enhanced thermostability of T. elongatus atpF. Experimental evidence shows that T. elongatus ATP synthase remains active at temperatures up to 95°C, with optimal activity at 55°C, far exceeding the temperature range of mesophilic cyanobacteria like Synechocystis .

  • Structural Stability: T. elongatus ATP synthase exhibits remarkably higher resistance to chaotropic agents compared to other cyanobacterial ATP synthases, suggesting specific structural adaptations in its subunits including atpF .

  • Sequence Variations: The molecular mass of subunit c in T. elongatus was determined by MALDI-TOF-MS to be 8238 Da, significantly different from the predicted 10,141 Da based on database sequences, indicating potential post-translational modifications specific to this thermophilic species .

Functional Comparisons:
ATPase inhibition experiments demonstrated similar regulatory patterns in both T. elongatus and Synechocystis 6803, where membrane samples from light-cultivated cells showed higher ATPase activities than those from dark-incubated cells. This suggests conservation of the basic regulatory mechanism despite the substantial differences in thermal properties .

These comparisons highlight how T. elongatus has maintained core structural and functional aspects of cyanobacterial ATP synthase while evolving specific adaptations for its thermophilic lifestyle .

What insights does T. elongatus atpF provide about evolutionary adaptations to extreme environments?

Thermosynechococcus elongatus atpF provides valuable insights into evolutionary adaptations to thermophilic environments, offering a window into how essential energy-generating machinery can be modified for extreme conditions:

1. Molecular Basis of Thermostability:
T. elongatus atpF exemplifies several classic thermophilic adaptations:

  • Enhanced hydrophobic core packing

  • Increased number of ionic interactions (salt bridges)

  • Reduction in thermolabile residues

  • Strategic placement of proline residues to restrict backbone flexibility

These features contribute to the extraordinary stability of T. elongatus ATP synthase, which remains functional even at 95°C .

2. Functional Trade-offs:
The comparison between thermophilic and mesophilic cyanobacterial ATP synthases reveals evolutionary trade-offs:

  • Increased stability often comes at the cost of reduced flexibility

  • The enzyme shows highest activity at its natural growth temperature (55°C), suggesting optimization for its ecological niche rather than maximum possible activity

  • Structural rigidity necessary for high-temperature function may limit conformational changes required for maximum catalytic efficiency at lower temperatures

3. Conserved Regulatory Mechanisms:
Despite adaptation to extreme environments, T. elongatus maintains core regulatory mechanisms found in mesophilic cyanobacteria:

  • The AtpΘ inhibitory system preventing futile ATP hydrolysis is preserved

  • Similar dark/light regulation patterns suggest conservation of energy management strategies despite thermal adaptation

4. Evolutionary Constraints and Solutions:
The atpF adaptations demonstrate how evolution navigates constraints when adapting core metabolic machinery:

The study of T. elongatus atpF thus provides a valuable model for understanding how essential multisubunit complexes can adapt to extreme conditions while maintaining their fundamental functions, offering insights that extend beyond cyanobacteria to general principles of protein evolution and adaptation .

What comparative genomic approaches can reveal functional variations in atpF across cyanobacterial species?

Comparative genomic approaches offer powerful methods to investigate functional variations in atpF across cyanobacterial species:

1. Sequence-Based Comparative Analyses:

  • Multiple sequence alignment (MSA) of atpF sequences from diverse cyanobacteria can identify:

    • Conserved domains likely essential for core functions

    • Variable regions potentially involved in species-specific adaptations

    • Coevolving residues that maintain structural and functional integrity

  • Phylogenetic analysis can:

    • Reveal evolutionary relationships between atpF variants

    • Identify instances of convergent evolution in different lineages

    • Map the acquisition of specialized features (like thermostability) onto the cyanobacterial tree

2. SNP Analysis and Functional Correlation:
Research has demonstrated that single nucleotide polymorphisms (SNPs) in ATP synthase genes can significantly impact function. For example, comparative genomics between Synechococcus 7942 and Synechococcus 2973 revealed that differences in ATP synthase alleles led to significantly different ATP synthesis rates when placed under the same proton motive force .

Similar approaches can be applied to atpF across cyanobacterial species to:

  • Identify SNPs correlating with specific phenotypes (thermotolerance, pH adaptation, etc.)

  • Map mutations that alter protein-protein interactions

  • Determine variations affecting regulatory responses

3. Structural Genomics Approaches:

  • Homology modeling based on available structures can predict:

    • Impact of sequence variations on protein folding

    • Effects on interaction surfaces with other subunits

    • Potential alterations in dynamic properties

  • Molecular dynamics simulations can reveal:

    • How sequence variations affect stability at different temperatures

    • Changes in flexibility and conformational dynamics

    • Altered interaction energies between subunits

4. Transcriptomic and Proteomic Integration:
Combining genomic data with transcriptomic and proteomic analyses can:

  • Determine if sequence variations correspond to altered expression patterns

  • Identify post-translational modifications specific to certain species

  • Reveal compensatory changes in other ATP synthase subunits

5. CRISPR-Enabled Approaches:
Modern genome editing techniques allow researchers to:

  • Swap atpF variants between species to directly test functional differences

  • Create chimeric proteins to map specific functional domains

  • Introduce point mutations identified by comparative genomics to verify their impact

A comprehensive study focusing on T. elongatus could systematically compare its atpF with those from diverse cyanobacteria inhabiting different thermal environments, potentially revealing the molecular basis for its exceptional thermostability and providing insights into environmental adaptation mechanisms .

What are the promising applications of thermostable T. elongatus atpF in synthetic biology?

The thermostable properties of T. elongatus atpF offer several promising applications in synthetic biology:

1. Engineering Thermostable Energy Systems:

  • Heat-resistant bioenergy platforms: Incorporation of T. elongatus atpF into synthetic ATP synthase complexes could enable the development of biological energy systems that function at elevated temperatures.

  • Biofuel production in extreme conditions: Engineered systems containing thermostable ATP synthase components could enhance ATP production in high-temperature fermentation processes.

  • Hybrid bioinorganic energy conversion: Combining thermostable atpF with artificial membranes and photosensitive materials for robust solar energy conversion .

2. Protein Engineering Applications:

  • Scaffold for engineering other membrane proteins: The exceptional stability of atpF provides a template for engineering thermostability into other membrane proteins.

  • Creation of chimeric proteins: Fusion of thermostable domains from T. elongatus atpF with functional domains from other proteins to enhance their thermal stability.

  • Structure-guided engineering: Using insights from T. elongatus atpF structure to develop algorithms for predicting stabilizing mutations in other proteins .

3. Biotechnological Tools:

  • Thermostable ATP regeneration systems: Development of in vitro ATP regeneration systems for high-temperature enzymatic reactions.

  • Biosensors functional at extreme conditions: Creation of ATP-dependent biosensors that can operate in harsh environments.

  • Protein production systems: Engineering expression hosts with T. elongatus ATP synthase components for improved energy metabolism at elevated temperatures .

4. Nanotechnology Applications:

  • Bionanomotors: Using the naturally evolved rotary motor properties of ATP synthase with thermostable components for nanodevices.

  • Targeted drug delivery systems: Development of thermostable protein-based nanocarriers that maintain structural integrity across a wide temperature range.

  • Biomolecular computing elements: Exploiting the binary states (active/inactive) of ATP synthase as computing elements resistant to thermal noise .

5. Understanding and Engineering Climate Resilience:

  • Model systems for climate adaptation: T. elongatus atpF provides insights into how energy-generating machinery might adapt to rising temperatures.

  • Engineering thermotolerance in crops: Transferring thermostability principles from T. elongatus atpF to improve photosynthetic efficiency in crop plants under heat stress .

These applications leverage the unique properties of T. elongatus atpF—its structural stability, temperature resistance, and functional integrity at high temperatures—to address challenges in biotechnology, energy production, and environmental adaptation .

What research gaps remain in understanding the structural determinants of T. elongatus atpF thermostability?

Despite significant advances in our understanding of T. elongatus atpF, several research gaps remain regarding the structural determinants of its exceptional thermostability:

1. Atomic-Level Structural Information:

  • Lack of high-resolution structures: While functional studies have been performed, there is still no atomic-resolution structure of T. elongatus atpF, limiting our understanding of specific stabilizing interactions.

  • Dynamic structural changes: Information about conformational changes during the catalytic cycle at high temperatures remains limited.

  • Hydration patterns: The role of water molecules and hydration dynamics in thermostability is poorly understood .

2. Molecular Basis of Thermostability:

3. Comparative Structural Biology:

  • Systematic comparison across temperature gradients: A comprehensive comparison of atpF structures from cyanobacteria adapted to different temperature ranges (psychrophilic, mesophilic, moderately thermophilic, extremely thermophilic) would reveal evolutionary trajectories of thermoadaptation.

  • Chimeric protein studies: Systematic studies with chimeric proteins containing domains from thermophilic and mesophilic atpF variants are needed to map thermostability determinants .

4. Functional Aspects of Thermostability:

  • Energy landscape characterization: How thermostability affects the energy landscape of conformational changes during ATP synthesis/hydrolysis needs further investigation.

  • Coupling efficiency at high temperatures: The relationship between structural rigidity necessary for thermostability and the flexibility required for efficient energy coupling remains to be fully characterized.

  • Proton conductance mechanisms: How the proton channel maintains functionality at high temperatures without increased proton leakage needs further study .

5. Integration with Other ATP Synthase Components:

  • Subunit interface adaptations: How interfaces between atpF and other subunits are optimized for high-temperature function.

  • Cooperative stability effects: How thermostability of individual subunits contributes to the remarkable stability of the entire complex against chaotropic agents .

  • Regulatory interactions: The detailed mechanism of interaction between atpF and regulatory proteins like AtpΘ at different temperatures needs further characterization .

Addressing these research gaps would not only enhance our understanding of T. elongatus atpF but would also provide broader insights into protein thermostability, the evolution of energy-converting enzymes, and principles for engineering heat-resistant bioenergetic systems .

How might advanced structural biology techniques advance our understanding of cyanobacterial ATP synthase components?

Advanced structural biology techniques offer tremendous potential to deepen our understanding of cyanobacterial ATP synthase components, including atpF:

1. Cryo-Electron Microscopy (Cryo-EM):

  • Whole-complex visualization: Cryo-EM can capture the entire ATP synthase complex without crystallization, revealing native arrangements of subunits including atpF.

  • Conformational states: Time-resolved cryo-EM could potentially capture different rotational states of the complex during the catalytic cycle.

  • Lipid-protein interactions: Recent advances in cryo-EM allow visualization of annular lipids, providing insights into how membrane environment stabilizes the Fo complex .

2. Integrative Structural Biology Approaches:

3. Advanced Spectroscopic Methods:

  • Solid-state NMR: Can provide atomic-level insights into membrane-embedded regions of atpF not accessible by other methods.

  • EPR spectroscopy: Using site-directed spin labeling to measure distances and monitor conformational changes within the complex.

  • Single-molecule FRET: Can track real-time conformational changes during ATP synthesis/hydrolysis cycles .

4. Time-Resolved Structural Methods:

  • Time-resolved X-ray crystallography: Using X-ray free-electron lasers (XFELs) to capture short-lived intermediate states.

  • Time-resolved cryo-EM: Capturing structural snapshots at different time points during function.

  • Temperature-jump experiments: Probing structural transitions relevant to thermostability in T. elongatus atpF .

5. Advanced Computational Methods:

  • Molecular dynamics simulations: Simulating behavior at different temperatures to understand thermostability.

  • Quantum mechanics/molecular mechanics (QM/MM): Modeling proton transfer events with quantum mechanical accuracy.

  • Machine learning approaches: Identifying subtle structural patterns associated with thermostability across multiple homologs .

Table: Comparative Analysis of Structural Techniques for ATP Synthase Components

TechniqueResolutionAdvantagesChallengesSpecific Insights for atpF
Cryo-EM2-4 ÅWhole complex, minimal sample prepLower resolution for small subunitsPeripheral stalk organization, subunit interfaces
X-ray Crystallography1-3 ÅAtomic detailsCrystallization difficultiesHigh-resolution interaction details
Solid-state NMRSite-specificMembrane environment compatibilitySample quantity, assignment complexityTransmembrane domain structure
Hydrogen-Deuterium Exchange MSPeptide-levelDynamics information, no size limitIndirect structural informationSolvent accessibility, binding interfaces
Integrative ModelingVariableCombines multiple data sourcesComputational complexityComplete structural model with dynamics

These advanced techniques would significantly enhance our understanding of how T. elongatus atpF contributes to the structure, function, and remarkable thermostability of cyanobacterial ATP synthase .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.