Recombinant Thermosynechococcus elongatus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The cobS gene from T. elongatus BP-1 is cloned into E. coli vectors under optimized promoters (e.g., T7 or psbA1) . Solubility challenges common to membrane-associated proteins are addressed using glycerol-enriched buffers, yielding >90% purity via Ni-NTA affinity chromatography . Key steps include:

  • Vector Design: Incorporates strong constitutive promoters and antibiotic resistance markers (e.g., spectinomycin) .

  • Yield: Reported yields exceed 10% of total soluble protein in optimized systems .

Functional and Biochemical Insights

  • Cofactor Dependence: Requires Mg²⁺ for activity, with optimal catalysis at pH 7.6 .

  • Kinetics: Exhibits a Kₘ of 0.97 μM for farnesyl pyrophosphate (FPP) and a kₐₜ of 0.11 min⁻¹ under standard conditions .

  • Inhibitors: Sensitive to zaragozic acid A, a squalene synthase inhibitor, though cobS specificity for its native substrates remains high .

Comparative Note: Unlike Synechococcus sp. PCC 11901, which retains cobalamin salvage genes (cobA, cobQ, cobS) but depends on exogenous B12 , T. elongatus cobS operates in a complete biosynthesis pathway, enabling autonomous cobalamin production .

Biotechnological Applications

  • Industrial Enzymology: Thermostability and high expression levels make it ideal for large-scale cobalamin production .

  • Metabolic Engineering: Used in synthetic biology platforms to enhance B12 synthesis in heterologous hosts (e.g., E. coli or Synechococcus) .

  • Research Tool: Facilitates studies on cyanobacterial adaptation to extreme environments and evolutionary loss of B12 autonomy .

Challenges and Future Directions

  • Solubility Optimization: Despite advances, recombinant cobS often requires detergents or chaperones for full activity .

  • Structural Resolution: No crystallographic data exists for T. elongatus cobS; homology modeling using Salmonella enterica CobS (PDB: 1N4P) remains tentative .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; tll1337; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
cobS
Target Protein Sequence
MKSLWQEWLGAIAFYTCLPISPRWPIQLAGAAKWCPWVGLVLGGMLWGVQWLLDFLQVPS PVASAVLVALWLALTGGLHLDGAMDTADGLAVRDQQRRLEVMADSRAGAFGVMAAMVILL LKVTSLSSLEKGSVLVWVLVLGRLAQVWAIARYPYLKPQGTGQIHKTSGVFPRDFWPSGL LVLLLSFLLPLPLGQLLFGLLLILLIPAWFQSQLGGHTGDSYGAVVEWTEALLLVAFTVG SAS
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) catalyzes the final two steps in cobalamin (vitamin B12) biosynthesis. Specifically, it joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: tel:tll1337

STRING: 197221.tll1337

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin Synthase (CobS) and its role in vitamin B12 biosynthesis?

Cobalamin synthase (CobS) is a polytopic integral membrane protein that catalyzes the penultimate step of the adenosylcobamide (coenzyme B12) biosynthetic pathway. Specifically, CobS catalyzes the condensation of the activated corrin ring and lower ligand base, representing a critical convergence of two pathways necessary for nucleotide loop assembly . This enzyme adds the lower ligand to the aminopropanol arm of the corrin ring, a step that is essential for the completion of vitamin B12 biosynthesis .

CobS function is highly conserved among all cobamide-producing bacteria and archaea, suggesting its evolutionary importance in the biosynthetic pathway. The enzyme is classified as EC 2.7.8.26 (adenosylcobinamide-GDP ribazoletransferase) and is also known as cobalamin-5'-phosphate synthase in some nomenclature systems .

How does T. elongatus CobS differ from CobS in heterotrophic bacteria?

T. elongatus, like other cyanobacteria, possesses distinct characteristics in its cobalamin biosynthetic pathway compared to heterotrophic bacteria:

FeatureCyanobacterial CobS (T. elongatus)Heterotrophic Bacterial CobS
Corrinoid variant producedPseudocobalamin (adenine as lower axial ligand)Cobalamin (DMB as lower axial ligand)
Gene organizationLacks bluB and cobU genesContains bluB and cobU genes
Lower ligand specificityIncorporates adenineIncorporates dimethylbenzimidazole (DMB)
Physiological roleEssential for cyanobacterial metabolismSupports growth of dependent organisms

While both enzymes catalyze similar reactions, T. elongatus CobS participates in pseudocobalamin synthesis pathways due to the absence of bluB and cobU genes that are responsible for producing and activating DMB substrates, respectively . This distinction is important for researchers working with recombinant T. elongatus CobS, as it influences substrate specificity and product formation.

What technical challenges are associated with expressing recombinant CobS?

Expression of recombinant CobS presents several challenges due to its nature as a polytopic membrane protein:

  • Membrane association: CobS is an integral membrane protein, making it difficult to express in soluble, functional form .

  • Protein folding: Ensuring proper folding and membrane insertion in heterologous expression systems requires careful optimization.

  • Purification complexity: Traditional purification methods may disrupt protein structure and function.

  • Activity measurement: Establishing reliable activity assays is challenging due to the complexity of substrates and membrane association.

Researchers have developed improved protocols for the isolation of CobS that yield highly homogenous protein. For example, with Salmonella CobS, protocols have been optimized to achieve 96% homogenous protein . Similar optimization strategies can be applied to T. elongatus CobS, focusing on detergent selection, stabilizing agents, and purification conditions.

What expression systems are most effective for producing functional recombinant T. elongatus CobS?

The optimal expression system depends on research objectives, but E. coli-based systems have proven successful for related CobS proteins:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, established protocolsMay require optimization for membrane proteins
E. coli C41/C43Designed for membrane protein expressionLower yields but better folding
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesHigher cost, technical complexity
Cyanobacterial hostsNative environment, potential for proper foldingSlower growth, fewer genetic tools

For T. elongatus CobS, an E. coli expression system with careful optimization of induction conditions (temperature, inducer concentration, duration) is typically recommended. The use of fusion partners such as N-terminal His-tags has been demonstrated to be effective for purification without compromising function .

How can membrane-associated CobS be effectively solubilized and purified while maintaining activity?

Effective solubilization and purification of CobS requires careful consideration of detergents and buffer conditions:

  • Detergent selection: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin maintain protein structure better than harsh detergents like SDS.

  • Buffer optimization: Including stabilizing agents such as glycerol (5-50%) and appropriate salts can enhance stability .

  • Purification strategy:

    • Initial solubilization in detergent-containing buffer

    • Affinity chromatography using fusion tags (typically His-tag)

    • Size exclusion chromatography for further purification

    • Optional reconstitution into liposomes for activity studies

  • Storage considerations: Purified CobS should be stored in buffer containing 6% trehalose at -20°C/-80°C, with aliquoting recommended to avoid freeze-thaw cycles .

Recent advances in membrane protein biochemistry, such as the use of styrene-maleic acid lipid particles (SMALPs) or nanodiscs, offer alternative approaches for studying CobS in a more native lipid environment.

What assays are available for measuring the activity of recombinant T. elongatus CobS?

Several complementary approaches can be used to assess CobS activity:

  • Direct product formation assay:

    • Measures the conversion of adenosylcobinamide-GDP and activated lower ligand to adenosylcobalamin phosphate

    • Detection via HPLC or LC-MS/MS

    • Requires purified substrates and sensitive detection methods

  • Coupled enzyme assays:

    • Links CobS activity to a detectable enzymatic reaction

    • Allows continuous monitoring of activity

    • Requires careful control experiments

  • Reconstitution systems:

    • Reconstitution of CobS into liposomes to investigate the effect of lipid environment on enzyme function

    • More physiologically relevant than detergent-solubilized systems

    • Allows assessment of membrane-associated factors on activity

  • In vivo complementation:

    • Functional complementation of CobS-deficient bacterial strains

    • Monitors growth or vitamin B12-dependent metabolic activities

    • Provides physiological relevance but less quantitative

The choice of assay depends on available resources, required sensitivity, and specific research questions.

How does lipid composition affect CobS activity, and how can this be studied?

The membrane association of CobS is conserved across diverse organisms, suggesting a functional importance of the lipid environment . To study this relationship:

  • Liposome reconstitution studies:

    • Purified CobS can be reconstituted into liposomes of defined composition

    • Systematic variation of lipid composition can reveal preferences

    • Activity measurements in different lipid environments provide insights into optimal conditions

  • Native membrane studies:

    • Isolation of native membranes containing CobS

    • Comparative analysis across different growth conditions

    • Correlation of activity with membrane composition

  • Site-directed mutagenesis:

    • Modification of potential membrane-interacting residues

    • Assessment of changes in membrane association and activity

    • Identification of critical protein-lipid interactions

Recent studies have shown that liposome-enhanced CobS activity can provide significant insights into the functional relationship between this enzyme and membrane components .

How can structural analysis be applied to understand the function of T. elongatus CobS?

Structural analysis of CobS presents challenges due to its membrane-embedded nature, but several approaches can be employed:

  • Homology modeling:

    • Based on known structures of related proteins

    • Prediction of functional domains and critical residues

    • Guide for experimental design

  • Cryogenic electron microscopy (cryo-EM):

    • Increasingly powerful for membrane protein structure determination

    • Can visualize protein in near-native lipid environment

    • May reveal conformational changes during catalysis

  • Site-directed mutagenesis coupled with functional assays:

    • Systematic mutation of conserved residues

    • Correlation of structural changes with activity

    • Identification of catalytic and substrate-binding residues

  • Cross-linking studies:

    • Identification of interaction partners and conformational states

    • Mapping of substrate binding sites

    • Understanding of quaternary structure

Research on Salmonella CobS has already identified residues and motifs critical for function through in vivo variant analyses . Similar approaches can be applied to T. elongatus CobS to understand its unique features.

What is known about the substrate specificity of CobS and how can this be experimentally determined?

The substrate specificity of CobS varies between organisms and determines the type of corrinoid produced:

  • Experimental approaches to determine specificity:

    • In vitro substrate binding analysis with purified CobS

    • Competition assays with various lower ligand precursors

    • Analysis of products formed with different substrates

    • Site-directed mutagenesis of putative substrate binding sites

  • Known specificity patterns:

    • Cyanobacterial CobS (including T. elongatus) produces pseudocobalamin with adenine as the lower axial ligand

    • Heterotrophic bacterial CobS produces cobalamin with DMB as the lower axial ligand

  • Physiological implications:

    • Different corrinoid variants have distinct biological activities

    • Specificity impacts ecological relationships between organisms

    • Understanding specificity can inform biotechnological applications

The amoebal grazing model described in the literature provides an excellent system for studying corrinoid specificity, as certain amoebae require specific corrinoid variants for growth .

How does corrinoid specificity influence microbial interactions, and can T. elongatus CobS be used to study these relationships?

Corrinoid specificity has profound implications for microbial ecology and can be studied using recombinant CobS:

  • Ecological implications:

    • Cyanobacteria produce pseudocobalamin, which is not efficiently utilized by many eukaryotes

    • This specificity shapes predator-prey relationships and nutrient transfer in microbial communities

    • The amoebal isolate LPG3 requires cobalamin from heterotrophic bacteria despite consuming cyanobacteria that produce pseudocobalamin

  • Research applications:

    • Reconstituted CobS systems can be used to produce different corrinoid variants

    • These variants can be tested in growth assays with various organisms

    • Genetic modification of CobS can potentially alter corrinoid production and impact ecological relationships

  • Evolutionary considerations:

    • Conservation of membrane association across diverse organisms suggests fundamental importance

    • Variation in substrate specificity reflects evolutionary adaptations

    • Comparative analysis of CobS from different organisms can reveal selective pressures

The study of T. elongatus CobS contributes to understanding how corrinoid metabolism shapes microbial communities and influences nutrient flux in aquatic environments .

How can researchers distinguish between pseudocobalamin and cobalamin production in experimental systems?

Distinguishing between different corrinoid variants is essential for accurate interpretation of results:

Detection MethodAdvantagesLimitations
HPLC analysisSeparates different corrinoid variantsRequires standards, moderate sensitivity
LC-MS/MSHighly specific, can identify novel variantsExpensive equipment, complex data analysis
BioassaysPhysiologically relevant, simple setupIndirect measurement, lower specificity
Genetic analysisIdentifies biosynthetic potentialDoesn't confirm actual production

For definitively distinguishing pseudocobalamin (adenine lower ligand) from cobalamin (DMB lower ligand), LC-MS/MS analysis is the gold standard. The lower axial ligand can be directly identified by its mass and fragmentation pattern after release from the corrinoid structure.

Complementary approaches include genetic analysis for the presence of bluB and cobU genes, which are required for cobalamin but not pseudocobalamin synthesis, as observed in the comparison between cyanobacteria and heterotrophic bacteria .

Why might recombinant CobS show low activity in vitro, and how can this be addressed?

Low activity of recombinant CobS can stem from multiple factors:

  • Protein denaturation or misfolding:

    • Optimize expression conditions (temperature, time, induction level)

    • Select appropriate detergents for solubilization

    • Consider fusion partners that enhance folding

  • Loss of essential cofactors:

    • Supplement purification buffers with potential cofactors

    • Conduct reconstitution experiments with various metal ions and coenzymes

    • Analyze native CobS for associated factors

  • Suboptimal assay conditions:

    • Systematically optimize pH, temperature, and ionic strength

    • Test different lipid compositions for reconstitution

    • Evaluate substrate quality and concentration

  • Storage-related activity loss:

    • Avoid repeated freeze-thaw cycles as recommended for similar proteins

    • Add stabilizing agents such as glycerol (5-50%) or trehalose (6%)

    • Aliquot purified protein for single use

Comprehensive troubleshooting may involve revisiting the expression and purification protocol, as has been done for Salmonella CobS where significant improvements in protein quality were achieved .

What control experiments are essential when working with recombinant CobS?

Robust experimental design requires appropriate controls:

  • Enzyme activity controls:

    • Heat-inactivated enzyme control

    • Catalytically inactive mutant (if available)

    • Substrate-free reactions

    • Time-zero measurements

  • Specificity controls:

    • Alternative substrates to confirm specificity

    • Competitive inhibition experiments

    • Cross-species complementation tests

  • Purification quality controls:

    • SDS-PAGE to confirm protein purity (>90% recommended)

    • Western blot to verify identity

    • Size exclusion chromatography to assess aggregation state

    • Mass spectrometry to confirm protein integrity

  • Reconstitution controls:

    • Protein-free liposomes

    • Alternative membrane proteins in same system

    • Variation in reconstitution protocols

These controls ensure that observed activities are specifically attributable to functional CobS and not to contaminating proteins or non-enzymatic reactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.