Recombinant Thermosynechococcus elongatus Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Introduction to Thermosynechococcus elongatus

Thermosynechococcus elongatus is a thermophilic unicellular cyanobacterium originally isolated from hot springs in Japan. The complete genome of T. elongatus BP-1 strain has been sequenced, revealing a circular chromosome of 2,593,857 base pairs with no plasmids . The genome encodes approximately 2,475 potential protein-encoding genes, with 56% showing sequence similarity to proteins of known function . T. elongatus has become an important model organism for studying photosynthesis, thermophilic adaptation, and protein transport mechanisms in cyanobacteria.

As a thermophilic organism, T. elongatus displays unique adaptations that differentiate it from mesophilic cyanobacteria, including a lack of genes for typical fatty acid desaturases and the presence of more heat-shock proteins . The organism possesses functional homologs of various transport systems, including the cobalt transport system represented by the CbiM protein.

One notable characteristic of T. elongatus is its capacity for organic carbon assimilation, specifically D-fructose, which opens possibilities for genetic modifications that might otherwise be lethal in purely photoautotrophic conditions . This metabolic flexibility has contributed to the organism's value as a research model, particularly for studies involving protein expression and metal transport.

Identification and Classification

The Cobalt transport protein CbiM (cbiM) is encoded by the tll2442 gene in the T. elongatus genome and is classified as an Energy-coupling factor (ECF) transporter substrate-capture protein . ECF transporters constitute a specialized subfamily of ATP-binding cassette (ABC) transporters recently identified in microorganisms, primarily responsible for micronutrient uptake from the environment .

CbiM functions as the substrate-binding component (S-component) of a modular ECF transporter complex that also includes additional proteins such as CbiN, CbiQ, and CbiO . These ECF transporters are classified into groups I and II, with the cobalt ECF transporter CbiMNQO belonging to group I .

Expression Systems and Methods

The recombinant production of T. elongatus CbiM protein typically utilizes Escherichia coli as the expression host due to its efficiency and scalability . The protein is generally expressed with an N-terminal His-tag to facilitate purification through affinity chromatography. The expression constructs are designed to include the mature protein sequence (amino acids 34-257), excluding signal peptides that might interfere with proper folding in a heterologous system .

Reconstitution Protocols

For experimental use, the lyophilized protein should be reconstituted following specific protocols to ensure proper folding and activity. According to manufacturer recommendations, the protein vial should be briefly centrifuged prior to opening to bring the contents to the bottom . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (typically 50% final concentration) for long-term storage at -20°C/-80°C .

The CbiMNQO Transport System

The CbiM protein functions as part of the CbiMNQO transporter complex, which represents one of the most widespread groups of microbial transporters for cobalt ions . This unusual uptake system contains an ABC protein (CbiO) but lacks an extracytoplasmic solute-binding protein that is typically found in classical ABC transporters .

The complete transporter consists of four components:

  1. CbiM: The substrate-binding component responsible for cobalt ion recognition

  2. CbiN: A small membrane protein necessary for coupling conformational changes

  3. CbiQ: The integral membrane scaffold component

  4. CbiO: The cytoplasmic ATP binding/hydrolysis component that provides energy for transport

Together, these components form a functional transport system that facilitates the selective uptake of cobalt ions across the cell membrane.

Mechanism of Cobalt Transport

The transport mechanism of the CbiMNQO complex involves a series of coordinated conformational changes driven by ATP hydrolysis. According to structural and functional studies, CbiM stimulates the basal ATPase activity of CbiQO, suggesting a regulatory role in transport efficiency .

The transport process appears to involve the rotation or toppling of both CbiQ and CbiM, with CbiN functioning in coupling conformational changes between these components . The substrate-gating function is attributed to the L1 loop of CbiM, which undergoes conformational changes during the transport cycle .

Research has demonstrated that CbiN plays a crucial role in inducing cobalt transport activity, even in the absence of CbiQO, when co-expressed with CbiM or as a Cbi(MN) fusion protein . The interaction between CbiM and CbiN involves specific loop-loop contacts that facilitate metal insertion into the binding pocket . Deletions in the CbiN loop abolish transport activity, highlighting the essential nature of these interactions .

  1. Cobalt binding to CbiM at the extracellular side

  2. CbiM-CbiN interaction facilitating metal insertion into the binding pocket

  3. Conformational changes transmitted to CbiQ

  4. ATP hydrolysis by CbiO driving further conformational changes

  5. Release of cobalt on the cytoplasmic side

  6. Reset of the transporter to the initial state

Regulation of CbiM Expression

The expression of cobalt transport systems, including CbiM, is often regulated in response to cobalt availability and metabolic needs. In many bacteria, riboswitches regulate the expression of cobalt transporters . Additionally, the genes encoding CbiM are frequently colocalized with genes involved in coenzyme B12 biosynthesis, suggesting coordinated regulation .

In T. elongatus, the specific regulatory mechanisms controlling CbiM expression have not been fully characterized, but genomic analysis suggests similar regulatory patterns as observed in other prokaryotes.

Comparison with CbiM from Other Organisms

The CbiM protein family is widely distributed among prokaryotes, with significant sequence and functional conservation. Comparative analysis of T. elongatus CbiM with homologs from other organisms reveals important structural and functional similarities.

For instance, the CbiM protein from Halobacterium salinarum (UniProt ID: B0R611) shows similar structural organization and function, though with distinct sequence variations that likely reflect adaptations to different environmental conditions . The H. salinarum CbiM consists of 220 amino acids (1-220) and functions as a putative cobalt transport protein within a similar transport complex .

Table 2: Comparison of CbiM Proteins from Different Organisms

CharacteristicT. elongatus CbiMH. salinarum CbiM
UniProt IDQ8DG81B0R611
Protein Length224 aa (34-257)220 aa (1-220)
Amino Acid Sequence SimilarityReferenceSignificant homology with sequence variations
Organism TypeThermophilic cyanobacteriumHalophilic archaeon
Environmental AdaptationHigh temperatureHigh salt concentration
Associated Transport ComplexCbiMNQOCbiMNQO

The sequence variations between CbiM proteins from different organisms likely reflect adaptations to specific environmental niches, such as high temperature in the case of T. elongatus and high salt concentration for H. salinarum.

Evolutionary Significance

The widespread distribution of CbiM-type transporters across diverse prokaryotic lineages suggests their ancient evolutionary origin and fundamental importance in metal homeostasis. Comparative genomic analysis has identified CbiMNQO and NikMNQO (for nickel transport) as the most common groups of microbial transporters for cobalt and nickel ions, respectively .

These transporters show a mosaic distribution in prokaryotic genomes, suggesting complex evolutionary histories involving horizontal gene transfer events. In fact, genomic analysis of Thermosynechococcus strains indicates active acquisition of putative horizontally transferred genes from other bacteria, enabling adaptation to different ecological niches and stressful conditions in hot springs .

Biotechnological Applications

The thermostable nature of proteins from T. elongatus, including CbiM, offers potential advantages for biotechnological applications. Some potential applications include:

  1. Development of biosensors for cobalt detection

  2. Engineering of microorganisms for enhanced cobalt accumulation or detoxification

  3. Production of cobalt-containing enzymes and coenzymes

  4. Improvement of microbial processes for vitamin B12 (cobalamin) biosynthesis

The structural and functional insights gained from studying T. elongatus CbiM can inform the design and optimization of these biotechnological applications.

Model System for Understanding Metal Transport

The CbiMNQO system serves as a valuable model for understanding the fundamental principles of metal transport across biological membranes. The insights gained from studying this system can be applied to other metal transport mechanisms, potentially leading to new strategies for addressing metal-related disorders or improving metal utilization in various biological systems.

Regulatory Mechanisms

Further investigation of the regulatory mechanisms controlling CbiM expression in T. elongatus would enhance our understanding of how this organism maintains cobalt homeostasis. This includes identifying potential riboswitches, transcription factors, or other regulatory elements that modulate CbiM expression in response to environmental signals.

Engineering Enhanced Variants

Protein engineering approaches could be employed to create enhanced variants of CbiM with improved transport efficiency or altered metal specificity. Such engineered proteins could have applications in bioremediation, metal recovery, or biotechnology.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement when placing the order. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please communicate your request in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbiM; tll2442; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-257
Protein Length
Full Length of Mature Protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
cbiM
Target Protein Sequence
MHISEGFLPLGWAVGWWLAFLPFLAWGLWSLQQQIKQHSESVLLVALAGAYAFVVSSLKI PSVTGSCSHPIGIALGAILFRPPLMAVLGTLVLLFQSLLIAHGGLTTLGANAFSMAVVGP WLAWLTYCGVSRLRVKPAIALFAASFISNVGTYTLTSLQLALAFPDSVGGLATSFAKFGT LFAVTQIPLAISEGLLTVLVWNWLTTYCVAELQALRLLPQEELP
Uniprot No.

Target Background

Function
CbiM is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which plays a crucial role in cobalt import.
Database Links

KEGG: tel:tll2442

STRING: 197221.tll2442

Protein Families
CbiM family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Thermosynechococcus elongatus and why is it significant for CbiM research?

Thermosynechococcus elongatus is a thermophilic unicellular cyanobacterium that dominates microbial mats in Asian non-acidic hot springs, particularly in temperature ranges of 50-65°C. This organism serves as a significant model for studying thermostable proteins, including membrane transporters like CbiM. As a major primary producer in its ecological niche, T. elongatus has evolved specialized mechanisms for nutrient acquisition that function at high temperatures, making its transport proteins particularly valuable for studying thermostability in membrane proteins . The strain T. elongatus BP-1 from Japan was one of the first thermophilic cyanobacteria to be fully sequenced, providing a complete genomic context for studying the cbiM gene and its regulation .

How does the CbiM transport system function in cobalt uptake?

The CbiM protein functions as the substrate-specific integral membrane component (S component) within an Energy-coupling Factor (ECF) transporter system specialized for cobalt uptake. Unlike typical ECF transporters for vitamins, metal-specific systems like CbiM require additional auxiliary proteins for proper function. The complete cobalt transport system typically consists of CbiM (substrate-binding protein), CbiQ (transmembrane coupling protein), CbiO (cytoplasmic ATP-binding cassette ATPase), and CbiN (auxiliary membrane component) .

The transport mechanism involves:

  • Initial interaction of cobalt ions with the binding pocket in CbiM

  • Critical loop-loop interactions between CbiM and CbiN that facilitate metal insertion

  • ATP hydrolysis by CbiO components that powers conformational changes

  • Rotation of the S component (CbiM) within the membrane to alternately expose the binding pocket to the exterior and cytoplasm

What techniques are commonly used to express recombinant CbiM protein from T. elongatus?

Expression of recombinant CbiM from T. elongatus typically employs specialized approaches to accommodate its thermophilic origin and membrane-embedded nature. The most effective methodologies include:

  • Heterologous expression systems:

    • E. coli strains optimized for membrane protein expression (C41, C43, or Lemo21)

    • Cell-free expression systems for difficult membrane proteins

    • Expression in other cyanobacterial hosts

  • Expression optimization strategies:

    • Temperature-controlled induction (starting at lower temperatures and gradually increasing)

    • Codon optimization for the expression host

    • Fusion tags that enhance solubility and membrane insertion

    • Use of specialized detergents for membrane protein solubilization

  • Genetic transformation approaches:

    • Electroporation combined with top agar methods for direct transformation of T. elongatus

    • Transformation into restriction endonuclease-deficient strains (such as tll2230-disruptant) to improve uptake of foreign DNA

    • Exploitation of the natural transformability of T. elongatus with carefully designed constructs

How can researchers optimize genetic transformation of T. elongatus for CbiM studies?

Genetic transformation of Thermosynechococcus elongatus presents specific challenges that can be addressed through several optimized approaches:

Table 1: Optimization Strategies for T. elongatus Transformation

StrategyMethodologyEfficiency EnhancementResearch Application
Combined electroporation with top agarApply electrical pulse to cells followed by embedding in low-concentration agarSignificantly increases transformation efficiency compared to either method aloneGene replacement and knockout studies of cbiM
Restriction endonuclease disruptionUse tll2230-disruptant strain as recipientEnables successful transformation with constructs that fail in wild typeIntroduction of modified cbiM variants
Natural transformationExploit inherent competence using pil gene homologsReduces cell damage compared to electroporationLong construct integration for cbiM fusion proteins
Recombination strategy selectionDesign for single or double crossover eventsSingle-crossover occurs more frequentlyAppropriate strategy selection for specific cbiM modifications

For optimal results when transforming T. elongatus with cbiM constructs, researchers should consider using the tll2230-disruptant strain as it shows markedly improved transformation efficiency, particularly with complex constructs that contain repetitive sequences or multiple modifications . The combination of electroporation with immediate plating in top agar provides mechanical protection to cells while maintaining sufficient access to nutrients and selective agents .

What methods are most effective for characterizing CbiM-CbiN interactions in cobalt transport?

Characterizing the critical interactions between CbiM and CbiN proteins requires multiple complementary approaches:

  • Cysteine-scanning mutagenesis and crosslinking:

    • Systematically replace amino acids in predicted interaction loops with cysteine residues

    • Apply oxidizing conditions to form disulfide bridges between proximal cysteines

    • Analyze crosslinked products by SDS-PAGE to map interaction points

    • This approach has successfully confirmed in silico predicted contacts between segments of the CbiN loop and loops in CbiM

  • Electron Paramagnetic Resonance (EPR) analysis:

    • Employ site-directed spin labeling at strategic positions in the CbiN loop

    • EPR spectroscopy reveals ordered structure of the CbiN loop

    • Compare mobility parameters between wild-type and mutant proteins

    • EPR studies have demonstrated that the N-terminal loop of CbiM containing three of four metal ligands is partially immobilized in functional protein but completely immobile in inactive variants

  • Solid-state Nuclear Magnetic Resonance (NMR):

    • Incorporate isotope-labeled proteins into proteoliposomes

    • Measure dynamics and structural changes upon interaction

    • Detect decreased dynamics in inactive forms compared to functional complexes

  • Functional transport assays:

    • Reconstitute purified components in liposomes

    • Measure cobalt uptake using radioisotopes or fluorescent indicators

    • Compare transport activity between wild-type and interaction-disrupted mutants

These methodologies collectively provide structural insights into how the loop-loop interactions between CbiM and CbiN facilitate metal insertion into the binding pocket and ultimately enable cobalt transport activity.

How can researchers create an effective expression system for functional studies of recombinant CbiM?

Developing an expression system for functional studies of CbiM requires careful consideration of protein integrity and transport activity. A systematic approach includes:

Table 2: Expression System Development for Functional CbiM Studies

StageKey ConsiderationsTechnical ApproachValidation Method
Vector designPromoter strength, induction controlUse thermostable promoters or inducible systems compatible with high temperaturesRT-qPCR to confirm expression levels
Fusion strategyMaintain membrane topology, minimize functional interferenceN- or C-terminal tags with flexible linkers; consider cleavable tagsWestern blot and membrane fractionation
Expression hostCompatibility with thermophilic protein, membrane insertionModified E. coli strains or homologous expression in cyanobacteriaMicroscopy with fluorescent fusion proteins
ReconstitutionLipid composition, proteoliposome preparationInclude native-like lipids; gentle detergent removalCircular dichroism to verify secondary structure
Functional assayTransport activity measurementCo²⁺ uptake assays with radioisotopes or metal-sensitive fluorophoresCompare with native protein activity

For functional expression, researchers should consider creating fusion constructs that combine CbiM with CbiN (Cbi(MN)), as these have demonstrated significant cobalt transport activity even in the absence of CbiQO₂ components . The extracytoplasmic loop of CbiN (37 amino acid residues) plays a critical role in transport function, and any deletions within this loop abolish activity .

How do genomic variations in cbiM across Thermosynechococcus strains impact cobalt transport efficiency?

Comparative genomic analyses of Thermosynechococcus strains reveal significant variations that potentially impact cobalt transport efficiency and adaptation to diverse hot spring environments:

Thermosynechococcus represents a genus with distinct genetic differentiation patterns that generally align with phylogenetic relationships . The genomic variations in metal transport systems, including the cbiM gene and associated transport components, likely reflect adaptations to different metal availability in their respective hot spring environments.

Analysis of strains from various geographic locations (Taiwan, Japan, China, and India) demonstrates that:

  • Strain-specific adaptations:

    • Taiwanese strains (TA-1 and CL-1) show unique genetic features including specialized transport systems that differ from Japanese strains

    • Despite high genetic relatedness (97.0% ANI) between Taiwanese strains, significant variations exist in gene content and chromosomal organization

  • Metal transporter variations:

    • Different Thermosynechococcus strains possess varying complements of metal transporters, which likely reflect the metal composition of their native hot springs

    • Strains from environments with limited cobalt availability may have evolved more efficient CbiM variants or regulatory mechanisms to enhance uptake capacity

  • Genomic context effects:

    • The genomic neighborhood of cbiM varies between strains, potentially affecting its expression and regulation

    • Transposase genes associated with synteny breakpoints contribute to the dynamic nature of chromosomal evolution and may impact operon structure around metal transporters

These variations underscore the importance of strain selection when studying CbiM function, as results from one strain may not be directly applicable to others despite their phylogenetic relatedness.

What role does CbiM play in the adaptation of T. elongatus to varying cobalt concentrations in hot spring environments?

CbiM plays a critical role in the adaptation of T. elongatus to different cobalt availability conditions through several mechanisms:

The thermophilic nature of T. elongatus presents additional challenges for metal transport, as protein dynamics and membrane fluidity differ at elevated temperatures. The CbiM protein's structure and function have evolved to maintain efficient transport under these conditions, potentially explaining the observed differences between thermophilic and mesophilic cobalt transporters.

How can structural biology approaches elucidate the thermostability mechanisms of the CbiM protein?

Understanding the thermostability mechanisms of CbiM from T. elongatus requires integrated structural biology approaches:

Table 3: Structural Biology Approaches for CbiM Thermostability Analysis

TechniqueInformation ProvidedTechnical ConsiderationsApplication to CbiM Research
X-ray crystallographyHigh-resolution static structureMembrane protein crystallization challenges; lipidic cubic phase methodsIdentify thermostability-conferring residues and interactions
Cryo-electron microscopyStructure of complete transporter complexSample preparation in detergent or nanodiscsVisualize CbiM in context with CbiN and other components
Hydrogen-deuterium exchange MSDynamic regions and solvent accessibilityTemperature-controlled exchange reactionsMap flexible vs. rigid regions at different temperatures
Molecular dynamics simulationsAtomistic motion and stability featuresForce field parameterization for high temperaturesCompare dynamics of thermophilic vs. mesophilic CbiM
Circular dichroism spectroscopySecondary structure stability over temperature rangeTemperature ramping experimentsDetermine thermal unfolding profiles and transition points

Investigations into the CbiM-CbiN interaction have shown that the N-terminal loop of CbiM contains three of the four metal ligands required for cobalt binding, and this loop becomes partially immobilized upon interaction with the CbiN loop . This structural arrangement likely contributes to both functional transport and thermostability through stabilizing interactions.

Key thermostability features to investigate include:

  • Increased ionic interactions, particularly salt bridges on the protein surface

  • Enhanced hydrophobic packing in the protein core

  • Reduced flexibility in loop regions through additional hydrogen bonding networks

  • Strategic placement of thermostabilizing amino acids (e.g., increased Ala, Glu, Arg; decreased Asn, Gln, Cys)

  • Specific adaptations in membrane-spanning regions to accommodate altered membrane fluidity at high temperatures

How can researchers distinguish between CbiM-mediated cobalt transport and other metal uptake pathways?

Precise characterization of CbiM-specific transport requires methodologies that differentiate between multiple potential metal uptake mechanisms:

  • Genetic approaches:

    • Generate clean deletion mutants of cbiM with minimal polar effects on adjacent genes

    • Create point mutations in metal-binding residues that specifically disrupt cobalt coordination

    • Complementation studies with wild-type or modified cbiM to confirm phenotype rescue

  • Metal specificity assays:

    • Compare uptake kinetics of radioactive cobalt (⁵⁷Co or ⁶⁰Co) in wild-type versus cbiM mutants

    • Perform competition assays with other divalent metals to determine transport specificity

    • Measure growth inhibition by toxic cobalt concentrations in strains with varying CbiM expression

  • Biochemical characterization:

    • Purify the reconstituted CbiM protein complex for direct binding assays

    • Determine binding affinities for cobalt versus other metals using isothermal titration calorimetry

    • Investigate the structural basis of metal selectivity through spectroscopic methods

  • Systems biology approaches:

    • Analyze transcriptomic responses to cobalt limitation in wild-type versus cbiM mutants

    • Perform metabolomic profiling to identify cobalt-dependent pathways affected by CbiM disruption

    • Use proteomics to quantify changes in cobalt-containing proteins in response to transport deficiencies

These approaches collectively enable researchers to establish the specific contribution of CbiM to cobalt homeostasis against the background of other potential transport systems or passive uptake mechanisms.

What experimental approaches can assess the interaction between CbiM and other components of the ECF transporter complex?

Investigating the interactions between CbiM and other components of the cobalt ECF transporter complex requires multifaceted approaches:

  • Co-purification strategies:

    • Tandem affinity purification with tags on different complex components

    • Size exclusion chromatography to isolate intact complexes

    • Blue native PAGE to preserve native protein-protein interactions

    • Quantitative assessment of complex stoichiometry through absolute quantification proteomics

  • Protein-protein interaction mapping:

    • In vivo crosslinking followed by mass spectrometry (XL-MS) to identify interaction interfaces

    • Bacterial two-hybrid or split-reporter assays to confirm direct interactions

    • FRET-based approaches using fluorescently labeled components to detect proximity in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions upon complex formation

  • Functional reconstitution:

    • Systematic reconstitution of purified components in defined lipid environments

    • Activity assays with various component combinations to determine minimal functional units

    • Single-molecule studies to observe conformational changes during transport cycles

Research has established that CbiN, despite its small size (two transmembrane helices with a 37-amino acid extracytoplasmic loop), plays an essential role in facilitating metal insertion into the CbiM binding pocket . The CbiN loop forms specific contacts with loops in CbiM, and these interactions are critical for transport activity, as evidenced by the complete loss of function when deletions are introduced in the CbiN loop .

How can researchers leverage the thermostability of T. elongatus CbiM for biotechnological applications?

The inherent thermostability of CbiM from T. elongatus presents several opportunities for biotechnological applications:

Table 4: Biotechnological Applications of Thermostable CbiM

Application AreaLeveraging ThermostabilityTechnical ApproachResearch Considerations
Protein engineering platformTemplate for designing thermostable metal transportersStructure-guided mutagenesis; domain swapping with mesophilic transportersMaintain transport function while enhancing stability features
Biosensors for cobalt detectionRobust detection in harsh environmentsCouple transport to reporter systems; immobilize on electrode surfacesSensitivity calibration at different temperatures
Bioremediation systemsMetal recovery from high-temperature industrial effluentsWhole-cell or reconstituted membrane systemsOptimize for selective metal uptake from complex mixtures
Synthetic biology partsHeat-resistant transport modules for designer microorganismsIntegration into thermophilic chassis organismsCompatibility with host metabolism and expression systems
Structural biology toolsModel system for membrane protein thermostabilityComparative analyses with mesophilic homologsIdentify transferable stability principles

Thermophilic cyanobacteria like T. elongatus are already recognized for their value in biotechnology applications due to their thermostable enzymes and bioproducts . The thermostable CbiM protein could be particularly valuable for:

  • Developing cobalt biosensors that function at elevated temperatures in industrial monitoring

  • Creating bioremediation systems for metal recovery from high-temperature industrial waste streams

  • Engineering metal transport capabilities into other organisms for enhanced metal accumulation or resistance

These applications build upon the natural adaptation of T. elongatus to hot spring environments and leverage the specialized metal transport mechanisms that have evolved in these thermophilic cyanobacteria.

What are the current knowledge gaps in understanding CbiM function and regulation in T. elongatus?

Despite significant advances, several critical knowledge gaps remain in our understanding of CbiM in Thermosynechococcus elongatus:

  • Structural determinants of thermostability:

    • High-resolution structures of thermophilic CbiM are lacking, particularly in complex with other transport components

    • The precise atomic interactions that confer thermostability remain largely hypothetical

    • Comparative structural studies between thermophilic and mesophilic CbiM homologs are needed

  • Regulatory mechanisms:

    • The transcriptional and post-translational regulation of cbiM expression in response to cobalt availability remains poorly characterized

    • Potential metal-sensing regulatory proteins that control cbiM expression have not been identified in T. elongatus

    • Integration of cobalt transport with other metal homeostasis systems is not well understood

  • Physiological context:

    • The relationship between CbiM function and vitamin B12 biosynthesis in thermophilic conditions needs further investigation

    • How cobalt transport integrates with photosynthetic function in hot spring environments remains to be elucidated

    • The ecological significance of strain-specific variations in metal transport systems across different hot springs warrants deeper exploration

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, molecular genetics, biochemistry, and ecological studies of natural hot spring populations.

What emerging technologies might advance research on thermophilic metal transporters like CbiM?

Several cutting-edge technologies hold promise for advancing our understanding of thermophilic metal transporters:

  • Cryo-electron tomography:

    • Enables visualization of membrane transporters in their native cellular context

    • Could reveal organization and distribution of CbiM complexes within the thylakoid and cytoplasmic membranes

    • May capture different conformational states during the transport cycle

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during transport

    • High-speed atomic force microscopy to observe topological changes in the membrane

    • Single-molecule force spectroscopy to measure stability and unfolding pathways

  • Advanced computational methods:

    • Machine learning approaches to predict stability-enhancing mutations

    • Molecular dynamics simulations at elevated temperatures to model thermostability mechanisms

    • Systems biology modeling to integrate metal transport with cellular metabolism

  • Synthetic biology platforms:

    • CRISPR-Cas systems adapted for thermophilic organisms to enable precise genome editing

    • Cell-free expression systems optimized for thermophilic membrane proteins

    • Minimal cell platforms to study transport functions in simplified contexts

  • Environmental 'omics:

    • Metagenomic and metatranscriptomic analyses of natural hot spring communities

    • In situ studies correlating metal availability with expression of transport systems

    • Comparative genomics across broader thermophilic taxa to identify convergent adaptations

These emerging technologies will help bridge current knowledge gaps and provide more comprehensive insights into the structure, function, and ecological significance of CbiM and related thermophilic metal transporters.

How might studies of CbiM in T. elongatus inform broader understanding of metal transport in extremophiles?

Research on the CbiM cobalt transporter in Thermosynechococcus elongatus serves as a valuable model for understanding fundamental principles of metal homeostasis in extremophiles:

  • Evolutionary adaptations:

    • Comparative analyses of CbiM across thermophiles, acidophiles, halophiles, and other extremophiles can reveal convergent or divergent strategies for metal acquisition under extreme conditions

    • Understanding how selective pressures in different extreme environments shape metal transport systems provides insights into microbial adaptation

  • Structure-function relationships:

    • The mechanisms that enable CbiM to function at high temperatures may inform general principles of protein thermostabilization

    • Identifying how protein dynamics and conformational changes are maintained under extreme conditions contributes to fundamental biophysical understanding

  • Ecological significance:

    • Metal transport in primary producers like T. elongatus impacts nutrient cycling in extreme environments

    • Understanding these transport systems helps explain community structures and succession patterns in extreme habitats

  • Biotechnological applications:

    • Principles derived from thermophilic metal transporters can inform the design of robust systems for bioremediation, metal recovery, and biosensing in harsh industrial conditions

    • The inherent stability of extremophile proteins makes them valuable templates for protein engineering

By elucidating the specific mechanisms of CbiM function in T. elongatus, researchers gain insights that extend beyond this specific system to enhance our broader understanding of how life adapts to extreme conditions, particularly with respect to essential metal acquisition and homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.