Recombinant Thermosynechococcus elongatus Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC; tlr0959; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
petC
Target Protein Sequence
MAQVSGMSDVPDMGRRQFMNLLTFGTITGTALGALYPVVKYFIPPASGGTGGGAVAKDAL GNDIKVSEYLAKHLPGDRSLAQGIKGDPTYVIVTEDHQIANYGLNAVCTHLGCVVPWNVS ENKFICPCHGSQYDSTGKVVRGPAPLSLALVKATVTEDDKLVFTPWTEIDFRTGKEPWWT
Uniprot No.

Target Background

Function
Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Gene References Into Functions
  1. The complete conservation of pocket-forming residues in all known PetC sequences highlights the functional importance of this pocket in the cytochrome b6f Rieske-type iron-sulfur cluster. PMID: 22993094
Database Links

KEGG: tel:tlr0959

STRING: 197221.tlr0959

Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does PetC play in it?

The cytochrome b6-f complex is essential for both photosynthetic and respiratory electron transport in cyanobacteria. It connects electron transport between photosystem II (PSII) and photosystem I (PSI) and resides in the thylakoid membranes . In cyanobacteria like Thermosynechococcus elongatus, it is present in both the thylakoid and cytoplasmic membranes .

The complex functions as a dimer with each monomer composed of multiple subunits:

Subunit composition of cytochrome b6f complex = [(PetA)(PetB)(PetN)(PetG)(PetD)(PetM)(PetC)]2

PetC (also known as the Rieske iron-sulfur protein) is one of the large subunits of this complex and contains an iron-sulfur cluster that plays a critical role in electron transfer. The complex oxidizes plastoquinol and subsequently transfers electrons to the soluble electron carrier plastocyanin . This process is crucial for both linear electron transport (from PSII to PSI) and cyclic electron transport around PSI.

Why is Thermosynechococcus elongatus particularly valuable for studying the cytochrome b6-f complex?

Thermosynechococcus elongatus BP-1 is a thermophilic strain of cyanobacteria discovered in a hot spring in Japan with unique properties that make it valuable for cytochrome b6-f complex studies:

  • It thrives at an optimal temperature of 57°C and cannot survive at temperatures below 30°C .

  • Its thermophilic nature provides enhanced protein stability, facilitating purification of intact, functional protein complexes.

  • The efficient transformability of this strain allows for genetic manipulation studies .

  • T. elongatus is naturally transformable with exogenous DNA, similar to Synechocystis sp. PCC 6803, as it contains homologs of pil genes .

  • Its thermophilic property serves as a natural biosafety mechanism when using genetically engineered organisms, limiting their spread if physical containment fails .

What are the optimal methods for recombinant expression of PetC from T. elongatus?

Based on established protocols for similar cyanobacterial proteins, the following methodology is recommended:

Cloning and Vector Construction:

  • Linearize an expression vector (e.g., pET-28b) with appropriate tag sequences (His-tag or Strep-tag)

  • Amplify the petC gene with primers containing appropriate overhangs for Gibson Assembly

  • Assemble the vector and insert, transform into E. coli DH5α for plasmid amplification and sequence confirmation

  • Transform the confirmed plasmid into an expression strain (e.g., E. coli BL21(DE3))

Expression Protocol:

  • Grow plasmid-bearing E. coli to OD600 of 0.5-0.6 with appropriate antibiotic selection

  • Induce protein expression with IPTG (concentration determined through optimization)

  • Incubate at reduced temperature (20-25°C) overnight to enhance soluble protein production

  • Harvest cells by centrifugation

Cell Disruption and Purification:

  • Resuspend cell pellets in appropriate buffer (e.g., 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 5% glycerol)

  • Disrupt cells using French press or sonication on ice

  • Clarify lysate by centrifugation at 27,000 × g at 4°C

  • Purify using affinity chromatography (StrepTactin for Strep-tagged proteins)

  • Wash column extensively and elute with appropriate buffer containing biotin

  • Assess purity by SDS-PAGE and pool pure fractions

How can I optimize expression conditions for maximum yield of functional PetC?

Response Surface Methodology (RSM) is a powerful multivariate statistical approach for optimizing recombinant protein expression:

RSM Implementation for PetC Expression:

  • Identify key variables: IPTG concentration, induction temperature, and induction duration

  • Design experimental conditions:

VariableTypical Optimization Range
IPTG concentration0.5 mM–2.3 mM
Induction temperature20°C–45°C
Induction period2 h–6 h
  • Use central composite design (CCD) with one replicate at the central point

  • Perform statistical analysis using software like Minitab Statistical Software to determine optimal conditions

Research indicates that induction temperature is typically the most influential factor, followed by IPTG concentration, while induction time is less critical when optimal inducer concentration is selected . The analysis of variance (ANOVA) should yield a correlation coefficient (R²) of at least 80% and p-value < 0.05 to confirm model validity .

What methods are most effective for assessing cytochrome b6-f complex activity?

Multiple complementary approaches can be used to characterize cytochrome b6-f complex activity:

Whole-Cell Level Analysis:

Isolated Complex Analysis:

  • Spectroscopic methods to monitor redox changes

  • Activity assays measuring electron transport rates

  • Stability assays comparing wild-type and mutant complexes

  • Structural characterization through X-ray crystallography or cryo-electron microscopy

Research on the PetP subunit demonstrates how these methods can reveal functional differences. Analysis of a ΔpetP mutant showed strong decrease in linear electron transport compared to wild type, while cyclic electron transport remained largely unaffected .

How does PetP deletion affect the cytochrome b6-f complex function in T. elongatus?

Studies characterizing a ΔpetP mutant reveal significant insights into complex regulation:

  • The wild-type cytochrome b6-f complex binds two PetP subunits (one per monomer)

  • Deletion of PetP results in:

    • Strongly decreased linear electron transport capability

    • Largely unaffected cyclic electron transport via PSI and cytochrome b6-f

    • Significantly reduced stability and activity of the isolated complex

  • These findings suggest the existence of two distinguishable pools of cytochrome b6-f complexes with different functions, potentially correlated with supercomplex formation

This research demonstrates how subunit deletion studies can provide valuable insights into the differential regulation of linear versus cyclic electron transport pathways.

How can I apply multivariate analysis to optimize recombinant PetC expression?

Multivariate analysis offers significant advantages over traditional univariate approaches:

Benefits of Multivariate Method:

  • Evaluates multiple variables simultaneously, considering interactions between them

  • Allows estimation of statistically significant variables

  • Enables characterization of experimental error

  • Permits comparison of variable effects when normalized

  • Gathers high-quality information with fewer experiments

Implementation Strategy:

  • Design experiments using statistical approaches like factorial designs

  • Evaluate significance of effects

  • Build mathematical models

  • Assess variable effects

  • Determine optimum conditions

This methodology has successfully been used to optimize many bioprocesses and is particularly valuable for heterologous protein expression optimization . When recombinant protein is expressed intracellularly, maximizing cell growth is often crucial for protein yield optimization .

What experimental controls should I include when working with recombinant PetC?

To ensure reliable and interpretable results, include these key controls:

  • Expression vector without insert - Controls for background protein expression

  • Non-induced culture - Establishes baseline expression levels

  • Wild-type T. elongatus cytochrome b6-f complex - Provides functional benchmark

  • Known inactive mutant - Negative control for activity assays

  • Purification from expression host without recombinant protein - Controls for host protein contamination

  • Thermostability control - Compare thermostability of recombinant protein with native complex

  • Iron-sulfur cluster incorporation - Spectroscopic analysis to confirm proper cluster assembly

How can the thermophilic nature of T. elongatus serve as a biosafety mechanism?

The temperature sensitivity of T. elongatus provides a natural biocontainment strategy:

Key Findings on Thermophilic Biocontainment:

  • T. elongatus BP1 has optimal growth at 57°C and cannot survive below 30°C according to previous analysis

  • Growth and survivability assays of wild-type and genetically engineered strains confirm temperature sensitivity

  • It typically takes 2-4 weeks for wild-type T. elongatus cells to die at cooler temperatures

  • Effective biocontainment is achieved at temperatures between 15.44°C and 25.30°C

  • This approach may be less effective at warmer temperatures

This thermophilic property can limit the spread of genetically engineered organisms if physical containment fails, providing an additional layer of biosafety particularly valuable for work with modified electron transport components like PetC.

How do PetC mutations affect electron transport through the cytochrome b6-f complex?

Site-directed mutagenesis of PetC can provide valuable insights into electron transport mechanisms:

What techniques are available for studying the real-time dynamics of electron transfer?

Advanced biophysical techniques can provide insights into electron transfer kinetics:

  • Spectroscopic methods:

    • Ultra-fast transient absorption spectroscopy

    • Time-resolved fluorescence spectroscopy

    • Electron paramagnetic resonance (EPR) for studying iron-sulfur centers

  • Electrochemical approaches:

    • Potential step methods for measuring electron transfer rates

    • Cyclic voltammetry for determining redox potentials

  • Computational modeling:

    • Molecular dynamics simulations

    • Quantum mechanical calculations of electron transfer pathways

How can recombinant PetC contribute to bioenergy applications?

The cytochrome b6-f complex is central to photosynthetic electron transport, with significant implications for bioenergy research:

  • Photosynthetic efficiency enhancement:

    • Understanding electron transport regulation could lead to engineered cyanobacteria with improved photosynthetic capacity

    • Potential for redirecting electron flow toward biofuel production

  • Thermostable biocatalysts:

    • T. elongatus proteins offer thermal stability advantages for industrial applications

    • Potential for developing heat-resistant bioprocessing systems

  • Synthetic biology applications:

    • T. elongatus has been considered for photosynthetic production of biofuels by inserting transgenic genes

    • PetC engineering could help optimize electron transport chains for bioproduct synthesis

  • Balancing electron transport pathways:

    • Insights into linear versus cyclic electron transport regulation (as seen in PetP studies) could be exploited to redirect electron flow toward desired products

How can I improve iron-sulfur cluster incorporation in recombinant PetC?

Producing functional iron-sulfur proteins with intact clusters presents several challenges:

Strategies to Enhance Cluster Assembly:

  • Supplement growth media with iron (ferrous ammonium sulfate) and sulfur sources (cysteine)

  • Co-express iron-sulfur cluster assembly proteins (ISC or SUF pathway components)

  • Optimize oxygen levels:

    • Consider microaerobic or anaerobic expression conditions

    • Include oxygen scavengers in purification buffers

  • Add reducing agents (DTT, β-mercaptoethanol) during purification to prevent cluster oxidation

  • Consider alternative expression hosts with enhanced capability for iron-sulfur protein expression

What should I consider when comparing recombinant PetC with the native complex?

When evaluating recombinant PetC against the native complex from T. elongatus:

  • Structural integrity - Confirm proper folding and cluster incorporation

  • Functional parameters:

    • Redox potential of the iron-sulfur cluster

    • Electron transfer rates

    • Thermostability profiles

    • Interaction with other complex components

  • Integration capability - Assess ability to assemble into the complete cytochrome b6-f complex

  • Post-translational modifications - Identify any modifications present in native but not recombinant protein

  • Environmental sensitivity - Compare response to pH, ionic strength, and temperature changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.