Recombinant Thermosynechococcus elongatus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petD; tlr0797; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-161
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
petD
Target Protein Sequence
MAKVLKKPDLTNPALRAKLKKGMGHNYYGEPAWPNDLLYIFPVVIMGTIALVIGLAVMDP AMVGEPADPFATPLEILPEWYLYPTFQIFRVVPNKLLGVLMNASIPLGLMLIPFIESVNK FQNPFRRPVAMTVFLFGTLVTLWLGIGAAFPLDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: tel:tlr0797

STRING: 197221.tlr0797

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the petD protein in Thermosynechococcus elongatus and what role does it play in the cytochrome b6/f complex?

The petD gene in Thermosynechococcus elongatus encodes subunit 4 of the cytochrome b6/f complex, which serves as an essential component of the photosynthetic electron transport chain. PetD forms a mildly protease-resistant subcomplex with cytochrome b6 that serves as a template for the assembly of other components of the b6/f complex . Specifically, this PetD-Cyt b6 subcomplex facilitates the assembly of Cyt f and PetG, producing a protease-resistant cytochrome moiety that is crucial for electron transfer between photosystem II and photosystem I .
PetD is essential for the functional integrity of the cytochrome b6/f complex. Studies have demonstrated that inactivation of PetD results in greatly reduced synthesis of Cyt f, highlighting the interdependence of these components in the assembly process . This interdependence illustrates the complex regulatory networks governing photosynthetic protein complex assembly.

What is the structural organization of the cytochrome b6/f complex containing petD?

The cytochrome b6/f complex forms a functional dimer in which PetD plays a crucial structural role. Within this complex, PetD associates with cytochrome b6 to form a subcomplex that serves as an assembly template for other components . This PetD-Cyt b6 subcomplex exhibits mild resistance to proteases, suggesting a stable structural arrangement .
The assembly process follows a defined sequence: first, Cyt b6 and PetD form their subcomplex, which then facilitates the assembly of Cyt f and PetG to produce a protease-resistant cytochrome moiety . Subsequently, the PetC and PetL proteins participate in the assembly of the functional dimer structure .
This hierarchical assembly process highlights the structural importance of PetD, as its absence leads to instability of the entire complex. Studies have shown that PetD becomes more unstable in the absence of Cyt b6, and the synthesis of Cyt f is greatly reduced when either Cyt b6 or PetD is inactivated . These observations underscore the interdependence of these components in maintaining the structural integrity of the cytochrome b6/f complex.

How is the expression of petD regulated in Thermosynechococcus elongatus?

Expression of petD in T. elongatus appears to be regulated through a mechanism known as CES (controlled by epistasy of synthesis), which coordinates the stoichiometry of different components within photosynthetic protein complexes . In this regulatory mechanism, the synthesis rate of chloroplast-encoded subunits is regulated by the availability of their assembly partners from the same complex .
Research in Chlamydomonas reinhardtii has revealed that unassembled Cyt f inhibits its own translation through a negative feedback mechanism, with proteins MCA1 and TCA1 involved in this regulation . While this specific mechanism is documented in C. reinhardtii, similar regulatory processes likely exist in T. elongatus, given the evolutionary conservation of photosynthetic machinery.
The interdependence of cytochrome b6/f complex components is evident in observations that the synthesis of Cyt f is greatly reduced when either Cyt b6 or PetD is inactivated . This suggests that both Cyt b6 and PetD are prerequisites for Cyt f synthesis, illustrating regulatory relationships among these components that ensure proper stoichiometry within the complex.

How does the DAC protein interact with petD during the assembly of the cytochrome b6/f complex?

The DAC (Defective Assembly of Cytochrome b6/f complex) protein plays a critical role in the assembly of PetD into the cytochrome b6/f complex . In dac mutants, newly synthesized PetD, Cyt b6, and Cyt f proteins show significantly reduced stability. Studies have demonstrated that the labeling of these proteins in dac mutants was only 30-40% of wild-type levels after 10 minutes of pulse labeling and more than 80% lower after 30 minutes of pulse labeling .
Only 10-15% of Cyt b6/f proteins accumulate in a stable manner in dac mutants, indicating that a considerable portion of newly synthesized proteins is rapidly degraded when DAC function is compromised . These findings suggest that DAC acts as a molecular chaperone or assembly factor that protects cytochrome b6/f components from degradation during the assembly process.
Interestingly, analysis of polysome association of petA and petD transcripts showed that this association remains unperturbed in dac mutants . This indicates that DAC's role is post-transcriptional, likely at the level of protein assembly or stability rather than gene expression regulation. The rapid degradation of newly synthesized proteins in dac mutants that cannot be efficiently assembled into complexes further supports this assembly-dependent protective function of DAC .

What specific amino acid residues in the petD protein are essential for its proper assembly into the cytochrome b6/f complex?

While specific amino acid residues essential for petD assembly have not been definitively identified in the provided literature, structural and functional studies suggest several critical regions. The formation of the protease-resistant subcomplex between petD and Cyt b6 indicates specific interaction interfaces that are likely mediated by conserved amino acid residues .
The assembly pathway of the cytochrome b6/f complex suggests that residues involved in the interaction with Cyt b6 would be particularly important for proper assembly, as this interaction forms the foundation for subsequent assembly steps . Additionally, residues involved in the interaction with the DAC assembly factor would also play crucial roles in ensuring proper complex formation.
Table 1: Comparison of petD in Various Cyanobacterial Species

SpeciesGenome SizepetD FeaturesThermostabilityAssembly Partners
T. elongatus BP-12,593,857 bpForms subcomplex with Cyt b6High (thermophilic)Cyt b6, DAC protein
Synechococcus sp.Varies by strainSimilar function, different sequenceLower (mesophilic)Similar components
Synechocystis PCC 6803~3.6 MbpHomologous functionLower (mesophilic)Similar components
Identification of these essential residues would require targeted mutagenesis studies combined with functional assays to assess complex assembly and stability. Techniques like site-directed mutagenesis to systematically alter specific amino acids, followed by assessment of the impact on complex assembly, would be valuable approaches for this research.

What experimental approaches can be used to study the kinetics of petD assembly into the cytochrome b6/f complex?

Several experimental approaches can be employed to study the kinetics of petD assembly into the cytochrome b6/f complex:

  • Pulse-chase labeling: This technique can track newly synthesized petD as it incorporates into the complex over time. Research has shown that in dac mutants, the labeling of Cyt f, Cyt b6, and PetD was 30-40% of wild-type levels after 10 minutes of pulse labeling and more than 80% lower after 30 minutes . Similar approaches could be used to track assembly under various conditions.

  • Blue native PAGE: This technique preserves protein-protein interactions and can be used to visualize the assembly of petD into intermediate subcomplexes and the final b6/f complex at different time points.

  • Time-resolved spectroscopy: Since the cytochrome b6/f complex contains chromophores with distinctive spectral properties, time-resolved spectroscopic techniques could monitor the formation of functional complexes.

  • Förster resonance energy transfer (FRET): By labeling petD and other complex components with appropriate fluorophores, FRET efficiency changes could indicate the proximity of subunits during the assembly process.

  • Size exclusion chromatography: This technique could separate assembly intermediates based on size, allowing for monitoring of complex formation over time.
    The search results indicate that a considerable part of newly synthesized PetD, Cyt b6, and Cyt f is rapidly degraded in dac mutants , suggesting that assembly kinetics are tightly coupled to protein stability. This observation provides an experimental framework for studying how assembly factors like DAC influence the kinetics of complex formation.

What are the optimal conditions for expressing recombinant Thermosynechococcus elongatus petD in heterologous systems?

Expressing recombinant T. elongatus petD in heterologous systems requires careful optimization due to its thermophilic origin and its nature as a component of a membrane protein complex:

  • Expression host selection: E. coli strains optimized for proteins with different codon usage (such as Rosetta or CodonPlus) are recommended, as they supply tRNAs for codons that may be rare in E. coli but more common in T. elongatus.

  • Temperature considerations: Given the thermophilic nature of T. elongatus, expression at elevated temperatures (30-37°C) may be beneficial for proper folding. Post-induction growth at temperatures closer to the natural environment of T. elongatus (45-55°C) might promote proper folding, although this needs to be balanced with the upper temperature limit tolerated by the expression host.

  • Vector design: T. elongatus has genes for genetic recombination (recA, recF, recG, recJ, and recQ) and transformation capabilities , which could potentially be leveraged for homologous expression systems. For heterologous expression, vectors with temperature-inducible promoters may be advantageous.

  • Fusion tags: Including fusion tags such as His-tag, GST, or MBP can improve solubility and facilitate purification. For membrane proteins like petD, these considerations are particularly important.

  • Membrane mimetics: Since petD is part of a membrane-bound complex, expression systems may need to include specific detergents or membrane mimetics to promote proper folding and stability.

What purification methods are most effective for isolating recombinant Thermosynechococcus elongatus petD?

Purification of recombinant T. elongatus petD requires specialized approaches due to its membrane protein nature:

  • Affinity chromatography: If expressed with a fusion tag (e.g., His-tag, GST), affinity chromatography provides an efficient first step in purification. For a His-tagged protein, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins would be employed.

  • Detergent solubilization: As a component of a membrane-bound complex, detergent solubilization is necessary. Common detergents for membrane protein purification include n-dodecyl β-D-maltoside (DDM), n-octyl glucoside (OG), or digitonin. The choice of detergent requires optimization based on protein stability and activity.

  • Size exclusion chromatography: This technique can separate monomeric petD from assembled complexes and remove aggregates. It's particularly useful as a final polishing step.

  • Ion exchange chromatography: This method can separate proteins based on charge differences and may be valuable for removing contaminants with similar sizes but different charge properties.

  • Temperature considerations: Given the thermophilic nature of T. elongatus, purification steps might benefit from being performed at elevated temperatures to maintain protein stability and solubility.

  • Specialized approaches: For structural studies, additional purification or stabilization methods might be needed, such as reconstitution into nanodiscs or liposomes, or the use of amphipols or styrene-maleic acid copolymer lipid particles (SMALPs) to maintain the native environment of the membrane protein.

How can site-directed mutagenesis be used to study the function of specific domains in Thermosynechococcus elongatus petD?

Site-directed mutagenesis offers a powerful approach for investigating the structure-function relationships in T. elongatus petD:

  • Target selection: Key targets for mutagenesis include:

    • Residues at the interface with Cyt b6, as petD forms a subcomplex with Cyt b6 that serves as a template for assembly

    • Residues potentially involved in the interaction with the DAC assembly factor

    • Conserved residues across cyanobacterial petD proteins, which likely have functional significance

    • Residues unique to thermophilic cyanobacteria, which might contribute to thermostability

  • Mutagenesis strategies:

    • Alanine scanning: Systematically replacing residues one by one with alanine to identify essential amino acids

    • Conservative substitutions: Replacing residues with chemically similar ones to probe the importance of specific chemical properties

    • Non-conservative substitutions: Introducing more dramatic changes to test functional hypotheses

    • Domain swapping: Exchanging domains between petD from thermophilic and mesophilic cyanobacteria to identify thermostability determinants

  • Functional assays:

    • Complex assembly assessment using blue native PAGE

    • Electron transport activity measurements

    • Protein stability determinations at various temperatures

    • Interaction studies with assembly factors like DAC
      T. elongatus contains genes for transformation and genetic recombination , suggesting that mutated versions of petD could potentially be introduced back into the organism for in vivo studies. Alternatively, mutated petD could be expressed in heterologous systems for in vitro analysis.

What spectroscopic techniques are most suitable for studying the structural properties of the cytochrome b6/f complex containing recombinant petD?

Several spectroscopic techniques are valuable for studying the structural properties of the cytochrome b6/f complex containing recombinant petD:

  • Circular dichroism (CD) spectroscopy: This technique can assess the secondary structure composition of petD and monitor structural changes induced by temperature, pH, or interactions with other proteins. It's particularly useful for comparing wild-type and mutant forms of petD.

  • Absorbance spectroscopy: The cytochrome b6/f complex contains heme groups with characteristic absorption spectra. Changes in these spectra can provide information about the environment of the hemes and the assembly state of the complex.

  • Fluorescence spectroscopy: If petD contains tryptophan residues or if specific fluorescent probes are introduced, this technique can provide information about protein folding, conformational changes, or binding interactions.

  • Electron paramagnetic resonance (EPR) spectroscopy: This is particularly valuable for studying the cytochrome b6/f complex as it contains multiple redox centers. EPR can provide information about the electronic structure of these centers and how they are affected by mutations in petD.

  • Förster resonance energy transfer (FRET): By introducing appropriate fluorophores, FRET can provide information about distances between specific sites in the assembled complex.

  • High-resolution structural techniques: For detailed structural information, X-ray crystallography or cryo-electron microscopy would be most suitable, providing atomic-level information about the entire complex and the specific position and interactions of petD within it.

How can recombinant Thermosynechococcus elongatus petD be used in photosynthesis research?

Recombinant T. elongatus petD offers several valuable applications in photosynthesis research:

  • Structure-function studies: The thermostable nature of T. elongatus petD makes it an excellent model for investigating the structural basis of cytochrome b6/f complex function. By introducing specific mutations and assessing their impact on electron transport, researchers can identify critical functional domains.

  • Comparative studies: Comparing the properties of petD from thermophilic T. elongatus with those from mesophilic cyanobacteria can provide insights into evolutionary adaptations of the photosynthetic apparatus to different environmental conditions .

  • Assembly studies: The well-defined assembly pathway of the cytochrome b6/f complex, in which petD plays a crucial role, provides a model system for studying the biogenesis of multiprotein complexes . The interaction with the DAC assembly factor offers a specific case study in protein complex assembly mechanisms.

  • Biophysical investigations: The thermostability of T. elongatus proteins, including petD, makes them amenable to biophysical studies that require elevated temperatures or extended experimental timeframes.

  • Engineered photosynthetic systems: Understanding the properties of T. elongatus petD could contribute to efforts to engineer more robust photosynthetic systems for biotechnological applications, potentially enhancing electron transport efficiency or stability under adverse conditions.

What are the key considerations for successful crystallization of the cytochrome b6/f complex containing recombinant petD?

Crystallization of the cytochrome b6/f complex containing recombinant petD presents several challenges that require specific strategies:

How might CRISPR-Cas technology be applied to study petD function in Thermosynechococcus elongatus?

CRISPR-Cas technology offers promising avenues for investigating petD function in T. elongatus:

  • Gene editing capabilities: CRISPR-Cas systems could enable precise modifications of the petD gene in its native context, allowing for the introduction of specific mutations to study structure-function relationships.

  • Genomic integration potential: T. elongatus possesses genes for genetic recombination (recA, recF, recG, recJ, and recQ) and natural transformation capabilities through genes like pilB, pilM, pilN, pilO, pilQ, comA, comE, and comM . These features could facilitate CRISPR-Cas-mediated genome editing.

  • Transcriptional regulation studies: CRISPR interference (CRISPRi) approaches could be used to modulate petD expression levels, providing insights into the regulatory relationships between different components of the cytochrome b6/f complex.

  • High-throughput mutagenesis: CRISPR-based approaches could enable the creation of libraries of petD variants to screen for specific properties, such as enhanced thermostability or altered electron transport characteristics.

  • Tagged protein production: CRISPR-Cas could be used to introduce tags at the genomic level, facilitating the purification and characterization of the native cytochrome b6/f complex containing petD.
    Implementing CRISPR-Cas systems in thermophilic organisms like T. elongatus would require optimization of the components to function at elevated temperatures, but the resulting tools would provide valuable capabilities for investigating the function of petD and other components of the photosynthetic apparatus.

What are the potential applications of engineered Thermosynechococcus elongatus petD variants in biotechnology?

Engineered T. elongatus petD variants offer several promising biotechnological applications:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.