Recombinant Thermosynechococcus elongatus Cytochrome c biogenesis protein CcsB (ccsB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccsB; ccs1; tll0683; Cytochrome c biogenesis protein CcsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
ccsB
Target Protein Sequence
MINAPVFRRVLALLGDLRLAILLLLVIAIASMAGTVIEQGQSLSFYQANYPENPALFGFL SWRVLLALGLDHVYRTPWYLTLLVLFGASLTACTLTRQVPALTTAQRWHYYQEPRQFTKL ALSTTIPQGSLTALATALRAKGYRVWQTDTQLYARKGLVGRLGPIVVHASMLLILLGGIL GALTGFMAQELIPSGETVHLQHIVEAGPLARIPQDWSVKVNRFWIDYTDAGEIDQFYSDL SIQDAKGQEVKRGTIHVNRPLRYGGVSLYQADWGIAAIRFRLNRSPVLQLPMAPLDTGGK GRLWGTWLPTRPDLSAGVSLIARDLQGTVLLYGPKGEFLTSLRTGMSTEVNGVTLTLVEL VGSTGLQIKADPGIPLFYAGFALLMAGVIMSYVSHSQVWGLQENQRLYLGGRTNRAQLAF EQELVAIARELAPPSQTTAVDL
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Database Links

KEGG: tel:tll0683

STRING: 197221.tll0683

Protein Families
Ccs1/CcsB family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of cytochrome c biogenesis protein CcsB in Thermosynechococcus elongatus?

Cytochrome c biogenesis protein CcsB in Thermosynechococcus elongatus functions as a key component in the System II (or Ccs) pathway for cytochrome c maturation. This pathway is prevalent in cyanobacteria, including thermophilic species like T. elongatus. The CcsB protein forms part of a membrane complex responsible for transporting heme across the membrane and facilitating its attachment to the apocytochrome.

CcsB specifically acts as a channel protein that coordinates with CcsA to form a complex that translocates heme to the periplasmic side of the membrane and maintains it in a reduced state for covalent attachment to the CXXCH motif of apocytochrome c. In T. elongatus, this process is particularly important given the extreme thermal conditions in which this organism thrives, requiring specialized protein machinery with enhanced thermostability .

What expression systems are recommended for recombinant T. elongatus CcsB protein production?

E. coli expression systems have been successfully employed for the recombinant production of T. elongatus CcsB protein, as evidenced by available recombinant products . When working with this expression system, researchers should consider the following methodological approaches:

  • Vector selection: pET series vectors with T7 promoters offer strong inducible expression suitable for membrane-associated proteins like CcsB.

  • E. coli strains: BL21(DE3) or Rosetta(DE3) strains are recommended, with the latter providing additional tRNAs that may enhance expression of proteins from organisms with different codon usage biases.

  • Induction conditions: Lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) often yield better results for membrane proteins by preventing inclusion body formation.

  • Media supplementation: Addition of membrane-stabilizing agents such as glycerol (5-10%) can improve proper folding and insertion of CcsB into membranes.

Given that T. elongatus is a thermophile, expression at elevated temperatures within the tolerable range for E. coli (30-37°C) may improve folding of this thermostable protein .

What structural characteristics define the CcsB protein from T. elongatus?

The CcsB protein from T. elongatus exhibits several notable structural features:

  • Protein length: The full-length protein consists of 442 amino acids .

  • Transmembrane domains: Computational analysis predicts that CcsB contains 6 transmembrane helices that anchor it within the membrane, with hydrophilic loops extending into both cytoplasmic and periplasmic spaces.

  • Conserved residues: Several histidine and cysteine residues are conserved across CcsB homologs and are critical for heme binding and transport.

  • Periplasmic domain: A large periplasmic domain contains the WWD domain (tryptophan-rich region) that participates in heme coordination.

  • Thermostability elements: As a protein from a thermophilic organism, CcsB likely contains structural features that contribute to thermostability, such as increased hydrophobic interactions, additional salt bridges, and potentially more rigid structural elements.

Though limited high-resolution structural data is available specifically for T. elongatus CcsB, molecular modeling based on homologous proteins suggests a structure adapted to maintain function at elevated temperatures characteristic of this thermophilic cyanobacterium .

How do storage and handling conditions affect recombinant T. elongatus CcsB protein stability?

For optimal stability and functionality of recombinant T. elongatus CcsB protein, researchers should implement the following evidence-based handling protocols:

  • Storage temperature: While the protein is provided as a lyophilized powder , reconstituted protein should be stored at -80°C for long-term storage, with working aliquots kept at -20°C.

  • Buffer composition: Stability is enhanced in buffers containing 50 mM Tris-HCl (pH 7.5-8.0), 150-300 mM NaCl, 5-10% glycerol, and potentially 0.05% mild detergent (such as DDM or LDAO) to maintain membrane protein solubility.

  • Freeze-thaw cycles: Multiple freeze-thaw cycles significantly reduce protein activity. Single-use aliquots are strongly recommended.

  • Temperature resistance: Being derived from a thermophilic organism, T. elongatus CcsB likely exhibits higher thermal stability than mesophilic homologs, potentially allowing handling at room temperature for short periods without significant degradation.

  • Reducing agents: Addition of mild reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) may help preserve key cysteine residues involved in heme interactions.

Given the thermophilic origin of this protein, it may exhibit unusual stability at elevated temperatures, but care should still be taken to minimize unnecessary temperature fluctuations .

What purification methods are recommended for recombinant His-tagged CcsB protein?

Recombinant His-tagged CcsB protein from T. elongatus can be efficiently purified using a methodical approach tailored to membrane-associated proteins:

  • Cell lysis: Sonication or pressure-based lysis (French press) in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitors, and 1% mild detergent (DDM, LDAO, or Triton X-100).

  • Membrane protein extraction: After initial centrifugation to remove cell debris, the membrane fraction containing CcsB should be collected by ultracentrifugation (100,000 × g, 1 hour) and solubilized with appropriate detergent (0.5-1%).

  • Immobilized metal affinity chromatography (IMAC):

    • Column: Ni-NTA or TALON resin

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% detergent, 20 mM imidazole

    • Wash buffer: Same as binding buffer with 40-60 mM imidazole

    • Elution buffer: Same as binding buffer with 250-300 mM imidazole

  • Size exclusion chromatography (SEC): For higher purity, SEC can separate oligomeric states and remove aggregates using Superdex 200 columns with running buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 0.03% detergent.

  • Concentration: Centrifugal concentrators with appropriate molecular weight cutoff (30-50 kDa) can be used, with care taken to avoid protein aggregation.

The purification protocol may benefit from higher working temperatures (room temperature rather than 4°C) due to the thermophilic nature of the protein .

How does the CcsB protein from thermophilic T. elongatus differ from homologous proteins in mesophilic cyanobacteria?

The CcsB protein from thermophilic T. elongatus exhibits several distinguishing features compared to its mesophilic counterparts:

FeatureT. elongatus CcsB (Thermophilic)Mesophilic Cyanobacterial CcsB
Amino acid compositionHigher percentage of charged residues (Arg, Lys, Glu)Lower percentage of charged residues
Hydrophobic coreMore extensive and compactLess extensive
Disulfide bondsPotentially increased numberFewer disulfide bonds
Proline contentHigher in loop regionsLower proline content
Salt bridgesMore numerousFewer salt bridges
FlexibilityReduced at ambient temperaturesHigher at ambient temperatures
Thermal stabilityMaintains function at 45-70°CDenatures at temperatures >45°C

Research methodologies to investigate these differences include:

  • Comparative sequence analysis using bioinformatics tools to identify consistent amino acid substitution patterns between thermophilic and mesophilic variants.

  • Differential scanning calorimetry to quantify and compare thermal stability parameters between homologs.

  • Circular dichroism spectroscopy to assess secondary structure stability across temperature ranges.

  • Site-directed mutagenesis of specific residues followed by thermal stability assays to identify key determinants of thermostability.

These adaptations in T. elongatus CcsB reflect evolutionary strategies for maintaining protein structure and function at elevated temperatures while preserving the critical activities required for cytochrome c biogenesis .

What experimental approaches can resolve contradictory data about CcsB interaction with cytochrome c?

Researchers encounter contradictory data regarding CcsB-cytochrome c interactions due to challenges in studying membrane protein complexes. The following methodological framework can help resolve such contradictions:

  • In vitro reconstitution systems:

    • Purify recombinant CcsB and cytochrome c from T. elongatus

    • Reconstitute CcsB into nanodiscs or liposomes

    • Measure binding using surface plasmon resonance (SPR) or microscale thermophoresis (MST)

    • Quantify binding under varying conditions (pH, ionic strength, temperature)

  • Chemical crosslinking coupled with mass spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to intact cells or membrane preparations

    • Digest and analyze crosslinked peptides by LC-MS/MS

    • Identify specific interacting residues between CcsB and cytochrome c

    • Compare crosslinking patterns under different physiological conditions

  • Site-directed mutagenesis validation:

    • Generate mutations in predicted interaction sites

    • Assess effects on cytochrome c maturation in vivo

    • Measure binding affinities of mutant proteins in vitro

    • Create a comprehensive interaction model based on mutational data

  • Single-molecule techniques:

    • Apply FRET or fluorescence correlation spectroscopy

    • Track real-time interactions between labeled proteins

    • Determine association/dissociation kinetics

    • Visualize conformational changes during interaction

  • Cryogenic electron microscopy:

    • Obtain structures of the CcsB-cytochrome c complex at near-atomic resolution

    • Compare structures in different functional states

    • Integrate with computational modeling approaches

This systematic approach can help reconcile contradictory findings by providing multiple independent lines of evidence regarding the nature of CcsB-cytochrome c interactions .

How can researchers optimize expression conditions to maintain the native conformation of recombinant CcsB protein?

Optimizing expression conditions for maintaining native conformation of T. elongatus CcsB requires a multifaceted approach:

  • Temperature optimization matrix:

Growth StageTemperatureDurationIPTG ConcentrationExpected Outcome
Initial growth37°CUntil OD600 0.6-0.8-Rapid cell growth
Post-induction20-30°C4-16 hours0.1-0.3 mMSlower expression, better folding
Thermophilic adaptation30-37°C2-4 hoursAlready inducedHeat shock response activation
  • Co-expression strategies:

    • Co-express with chaperones (GroEL/ES, DnaK/J) to aid folding

    • Include heme synthesis genes to ensure cofactor availability

    • Co-express with CcsA partner protein to promote complex formation

  • Media and additives optimization:

    • Supplement with δ-aminolevulinic acid (ALA, 50-100 μM) to boost heme synthesis

    • Add glycerol (5-10%) to stabilize membrane proteins

    • Include mild detergents (0.05% Triton X-100) during induction

  • Membrane integration assessment:

    • Fractionate cells to quantify properly inserted protein versus inclusion bodies

    • Implement Western blotting with anti-His antibodies on different cellular fractions

    • Apply protease accessibility assays to confirm proper membrane topology

  • Functional validation:

    • Develop heme-binding assays to confirm functionality

    • Assess cytochrome c maturation in complementation systems

    • Measure thermostability of purified protein to confirm native-like properties

This comprehensive approach acknowledges that maintaining native conformation of membrane proteins like CcsB requires careful optimization at multiple stages of expression and purification .

What are the implications of group II introns in the T. elongatus genome for CcsB protein expression and function?

The presence of 28 copies of group II introns in the T. elongatus genome has significant implications for CcsB protein expression and function:

  • Potential impact on gene expression regulation:

    • Group II introns may create alternative splicing variants of the CcsB transcript

    • Splicing efficiency may be temperature-dependent, creating a regulatory mechanism

    • Self-splicing activity might be influenced by physiological conditions, affecting protein levels

  • Experimental approaches to investigate intron effects:

    • RT-PCR analysis to identify potential splice variants of CcsB mRNA

    • Northern blotting to quantify spliced vs. unspliced transcripts under different conditions

    • Creation of intron-free constructs to compare expression levels with native sequences

    • RNA-seq to map precise exon-intron boundaries and detect novel transcripts

  • Evolutionarily relevant hypotheses:

    • Group II introns may have contributed to the evolution of thermostable protein variants

    • Horizontal gene transfer events involving these mobile genetic elements may have shaped the unique properties of T. elongatus CcsB

    • The thermophilic environment may select for particular intron-exon structures affecting protein expression

  • Methodological considerations for recombinant expression:

    • When expressing in E. coli, consider using codon-optimized cDNA sequences lacking introns

    • For studies of native regulation, maintain intronic sequences in constructs

    • Implement temperature-variable expression systems to examine splicing effects

These considerations underscore the importance of understanding the genomic context when investigating protein expression and function in organisms with complex RNA processing mechanisms like T. elongatus .

What advanced biophysical techniques are most informative for studying CcsB-mediated protein-protein interactions?

To comprehensively characterize CcsB-mediated protein-protein interactions, researchers should employ a strategic combination of advanced biophysical techniques:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Methodology: Expose protein complexes to D2O buffer, analyze deuterium incorporation patterns

    • Application: Identify regions of CcsB that change solvent accessibility upon interaction with partner proteins

    • Advantage: Works with membrane proteins in detergent or lipid environments

    • Data interpretation: Decreased deuterium uptake indicates protected interaction surfaces

  • Single-particle cryo-electron microscopy:

    • Methodology: Vitrify purified CcsB complexes, collect thousands of 2D images, reconstruct 3D structure

    • Application: Determine structural arrangement of CcsB with partners at near-atomic resolution

    • Advantage: Allows visualization of conformational states and flexible regions

    • Data acquisition: Requires ~0.1-0.5 mg/ml pure protein in detergent micelles or nanodiscs

  • Förster resonance energy transfer (FRET) spectroscopy:

    • Methodology: Label CcsB and partner proteins with fluorophore pairs, measure energy transfer

    • Application: Monitor real-time assembly/disassembly of complexes in membrane environments

    • Quantification: Calculate distances between specific labeled residues (2-10 nm range)

    • Advanced implementation: Single-molecule FRET to observe conformational heterogeneity

  • Native mass spectrometry:

    • Methodology: Ionize intact protein complexes under native conditions, analyze by MS

    • Application: Determine stoichiometry, binding affinities, and assembly pathways

    • Technical challenge: Requires specialized instrumentation for membrane protein complexes

    • Data output: Mass/charge ratios reflecting intact complexes and subcomplexes

  • Isothermal titration calorimetry (ITC):

    • Methodology: Measure heat changes during binding events in solution

    • Application: Quantify thermodynamic parameters (ΔH, ΔS, Kd) of CcsB interactions

    • Thermophilic advantage: Can perform measurements at elevated temperatures relevant to T. elongatus

    • Data requirements: 0.5-2 mg/ml protein, stoichiometric titrations

These sophisticated techniques, used in combination, provide complementary data on structural, thermodynamic, and kinetic aspects of CcsB-mediated interactions, enabling researchers to construct comprehensive interaction models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.