Recombinant Thermosynechococcus elongatus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipoprotein Processing

SPase II cleaves signal peptides from prolipoproteins, enabling their anchoring to bacterial membranes. In T. elongatus, lspA shares conserved residues with homologs in Rickettsia typhi and E. coli, confirming its catalytic role .

Key Findings from Functional Assays

  • Globomycin Resistance: Overexpression of T. elongatus lspA in E. coli confers resistance to globomycin (a SPase II inhibitor), validating its activity .

  • Genetic Complementation: In E. coli strain Y815 (temperature-sensitive SPase II mutant), T. elongatus lspA restored growth at 42°C, albeit with lower efficiency (~4.7%) compared to E. coli lspA (~21.5%) .

  • Substrate Specificity: Preferentially processes lipoproteins amidated on the d-iso-glutamyl residue, as inferred from structural homology with Rickettsia spp. and E. coli SPase II .

Applications and Research Potential

Recombinant T. elongatus lspA offers opportunities in:

ApplicationRationale
Industrial Enzyme ProductionThermostable lspA could optimize lipoprotein processing in high-temperature bioreactors .
Antibiotic TargetingSPase II inhibitors (e.g., globomycin) may exploit conserved catalytic sites for antimicrobial development .
Protein EngineeringDirected evolution to enhance activity or substrate specificity .

Comparative Analysis with Homologs

OrganismKey FeatureReference
Rickettsia typhiHigher genetic complementation efficiency (21.5% vs. 4.7%) in E. coli Y815
E. coliGlobomycin resistance and codon-optimized expression
Thermosynechococcus elongatusThermostability and natural genetic transformability

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
lspA; tlr2420; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
lspA
Target Protein Sequence
MSSRHFKIKNSLFWWVAGLALASDRLTKAWIVATYALTVPPQTTPIIPGVFHITYVTNTG AAFSLFANGSIWLRWLSLIVSLGLITWAILGPRLDRWQQVGYGCLLGGALGNGIDRFLTG EVVDFLDFRWIQFPVFNVADIAINIGIVCLLWSAWHPR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: tel:tlr2420

STRING: 197221.tlr2420

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.