Recombinant Thermosynechococcus elongatus NAD (P)H-quinone oxidoreductase subunit 3 (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; tlr1429; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-132
Protein Length
Full Length of Mature Protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
ndhC
Target Protein Sequence
VAIPRLRDTATVFVLSGYEYFLGFLIICSLVPVLALAASALLRPKSGRMIRLTTYESGME PIGGAWIQFNVRYYMFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILVVALV YAWRKRALEWS
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from an unidentified electron donor, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chain. In this organism, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also contributes to inorganic carbon concentration.
Database Links

KEGG: tel:tlr1429

STRING: 197221.tlr1429

Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of ndhC within the NDH-1 complex of T. elongatus?

The ndhC subunit functions as an integral component of the NDH-1 complex in Thermosynechococcus elongatus, participating in electron transfer processes essential for both respiratory and photosynthetic pathways. This subunit contributes to the formation of the membrane domain of the NDH-1 complex, which has been identified in three distinct forms through blue-native/SDS/PAGE analysis: NDH-1L (~450 kDa), NDH-1M (~300 kDa), and NDH-1S (~190 kDa) . A larger complex of approximately 490 kDa has also been isolated from specifically tagged strains. The ndhC subunit likely plays a critical role in the assembly and stability of these complexes, particularly in maintaining the structural integrity required for efficient electron transfer from NAD(P)H to quinones. Within this thermophilic cyanobacterium, the NDH-1 complex demonstrates remarkable thermal stability, making it particularly valuable for understanding structure-function relationships in related enzymes across different organisms.

How does ndhC contribute to the electron transport chain in cyanobacteria?

The ndhC subunit participates in the NAD(P)H dehydrogenase complex that catalyzes the transfer of electrons from NAD(P)H to the quinone pool. In the electron transport chain of T. elongatus, this process is fundamental to both respiratory and cyclic electron transport. The electron transfer function involves the catalysis of quinone reduction through employing NAD(P)H as an electron donor, similar to the mechanism observed in NAD(P)H:quinone oxidoreductase (NQO) enzymes in other systems . This electron transfer capability enables the NDH-1 complex to contribute to proton gradient formation across the thylakoid membrane, which is subsequently utilized for ATP synthesis. Additionally, the NDH-1 complex participates in cyclic electron flow around Photosystem I, a process that becomes particularly important under stress conditions or when ATP demand exceeds that produced by linear electron flow alone.

What expression systems are most effective for recombinant production of ndhC from T. elongatus?

For successful recombinant expression of ndhC from Thermosynechococcus elongatus, several expression systems have been evaluated with varying degrees of success. The most effective approach involves using Escherichia coli expression systems optimized for membrane proteins, particularly those employing BL21(DE3) derivatives with modified chaperone systems. When designing expression constructs, incorporating histidine tags (His-tags) has proven particularly valuable for subsequent purification steps, as demonstrated in studies where His-tagged NDH-1 subunits were successfully isolated using Ni²⁺ column chromatography .

Expression temperature control is critical when working with thermophilic proteins like those from T. elongatus. A typical protocol involves initial growth at 37°C until an optimal OD₆₀₀ is reached (usually 0.6-0.8), followed by temperature reduction to 18-25°C prior to induction with IPTG (typically at 0.2-0.5 mM). This temperature downshift helps minimize inclusion body formation while maintaining reasonable expression yields. For T. elongatus proteins specifically, maintaining expression temperatures between 25-30°C often provides the best balance between proper folding and expression levels.

What purification strategies yield the highest purity and activity for recombinant ndhC?

The most effective purification strategy for recombinant ndhC from T. elongatus employs a multi-step approach leveraging affinity chromatography followed by additional purification steps. Initial purification typically involves immobilized metal affinity chromatography (IMAC) using Ni²⁺ columns when His-tagged constructs are employed . This one-step approach has been successfully used to isolate intact NDH-1 complexes from T. elongatus strains with His-tags on various subunits.

A detailed purification protocol might include:

  • Cell lysis in a buffer containing 50 mM Tris-HCl (pH 7.5-8.0), 300 mM NaCl, 10% glycerol, and appropriate protease inhibitors

  • Membrane solubilization using mild detergents (0.5-1% n-dodecyl β-D-maltoside)

  • IMAC purification on Ni²⁺-NTA resin with stepwise imidazole elution

  • Size exclusion chromatography to separate different NDH-1 complex forms

  • Optional ion exchange chromatography for higher purity

This approach has successfully yielded NDH-1 complexes of varying sizes (190-490 kDa) suitable for downstream structural and functional analyses . Maintaining the native complex integrity is essential for functional studies, as the isolated ndhC may not maintain proper folding or activity outside its native complex environment.

What methods are most informative for determining the structure of ndhC within the NDH-1 complex?

Determining the structure of ndhC within its native NDH-1 complex requires complementary analytical approaches. Blue-native/SDS/PAGE analysis has been successfully employed to resolve the various NDH-1 complex forms (NDH-1L, NDH-1M, NDH-1S) and estimate their molecular masses at approximately 450, 300, and 190 kDa, respectively . This technique provides valuable information about the complex integrity and subunit composition.

For higher resolution structural information, cryo-electron microscopy (cryo-EM) represents the most promising approach, particularly given the recent advances in single-particle analysis techniques. Sample preparation for cryo-EM typically involves purifying the NDH-1 complex using the aforementioned strategies, followed by grid preparation in the presence of detergent or reconstitution into nanodiscs or liposomes to maintain the native membrane environment. To ensure sample homogeneity for cryo-EM studies, gradient ultracentrifugation or additional chromatography steps may be required.

X-ray crystallography, while traditionally challenging for membrane protein complexes, may be applicable using crystallization techniques specifically optimized for membrane proteins, such as lipidic cubic phase crystallization. Complementary techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable information about solvent accessibility and protein dynamics, helping to understand ndhC's position and interaction interfaces within the larger complex.

How can protein-protein interactions between ndhC and other NDH-1 subunits be mapped?

Mapping protein-protein interactions between ndhC and other NDH-1 subunits requires specialized techniques appropriate for membrane protein complexes. Chemical crosslinking combined with mass spectrometry (XL-MS) represents a powerful approach to identify interaction interfaces. This technique involves treating purified complexes with various crosslinking agents (e.g., BS3, DSS, or EDC) followed by proteomic analysis to identify crosslinked peptides, revealing proximities between specific amino acid residues.

Co-immunoprecipitation experiments using antibodies against ndhC or other NDH-1 subunits can identify stable interaction partners. Additionally, genetic approaches such as bacterial two-hybrid systems or split-GFP complementation assays can be adapted to study specific binary interactions between ndhC and candidate partner subunits. For a comprehensive understanding of the interaction network, pull-down experiments using various tagged NDH-1 subunits from T. elongatus, similar to those performed with His-tagged CupA and NdhL , can reveal which subunits co-purify with ndhC under different solubilization and purification conditions.

What assay systems effectively measure the electron transfer activity of recombinant ndhC?

Measuring the electron transfer activity involving recombinant ndhC requires assays that monitor the NAD(P)H oxidation and/or quinone reduction activities of the reconstituted NDH-1 complex. Spectrophotometric assays tracking the oxidation of NAD(P)H at 340 nm provide a straightforward approach to monitoring activity. A typical reaction mixture would contain purified NDH-1 complex (containing ndhC), NAD(P)H (100-200 μM), and appropriate quinone acceptors (such as ubiquinone analogues) in a suitable buffer system.

For more sophisticated analysis, oxygen consumption measurements using Clark-type electrodes can assess NDH-1 activity in membrane preparations or reconstituted proteoliposomes. Additionally, artificial electron acceptors like ferricyanide or 2,6-dichlorophenolindophenol (DCPIP) can be employed in colorimetric assays that monitor absorbance changes as these compounds are reduced. When studying the specific contribution of ndhC, comparative analyses between wild-type complexes and those with modified or absent ndhC are essential to delineate its particular role in electron transfer activities.

Recent advances in electrochemical techniques, including protein film voltammetry, offer promising approaches to directly measure electron transfer rates from purified NDH-1 complexes immobilized on electrode surfaces, providing insights into the thermodynamic and kinetic properties of these processes.

How does ndhC contribute to CO₂ uptake mechanisms in T. elongatus?

The NDH-1 complex in cyanobacteria plays a significant role in CO₂ uptake mechanisms, with distinct complex variants containing specific subunits dedicated to this function. While ndhC itself is not among the specialized CO₂ uptake subunits (such as CupA), it contributes to the core structure and electron transfer capabilities of the NDH-1 complex that supports these specialized functions .

The CO₂ uptake function can be assessed through bicarbonate depletion assays, where 14C-labeled bicarbonate uptake is measured in intact cells or reconstituted membrane systems containing the NDH-1 complex. Comparative studies between wild-type organisms and those with modified ndhC can elucidate the specific contribution of this subunit to CO₂ uptake efficiency. Real-time measurements of CO₂ concentration changes using membrane-inlet mass spectrometry (MIMS) provide another valuable approach to quantifying CO₂ uptake rates with high sensitivity and temporal resolution.

Understanding ndhC's role in CO₂ uptake has significant implications for photosynthetic efficiency and carbon concentration mechanisms in cyanobacteria, potentially informing strategies to enhance carbon fixation in both natural and engineered biological systems.

What strategies are effective for site-directed mutagenesis of ndhC in T. elongatus?

Effective site-directed mutagenesis of ndhC in T. elongatus requires consideration of both the genetic manipulation techniques and the thermophilic nature of this organism. For in vivo studies, homologous recombination-based approaches have proven successful in introducing targeted mutations into the T. elongatus genome. This typically involves creating a construct containing the mutated ndhC gene flanked by homologous regions, along with a selectable marker, followed by transformation and selection under appropriate conditions.

For recombinant protein studies, standard site-directed mutagenesis techniques can be applied to ndhC expression constructs prior to heterologous expression. The QuikChange mutagenesis system or overlap extension PCR methods are particularly suitable. When designing mutations, consideration should be given to conserved residues identified through multiple sequence alignments with ndhC homologs from other cyanobacteria and photosynthetic organisms. Target sites might include:

  • Predicted quinone-binding residues (typically involving aromatic and charged amino acids)

  • Residues at predicted subunit interfaces

  • Highly conserved residues likely essential for protein folding or function

Following mutagenesis, verification through sequencing is essential, and the impact of mutations should be assessed through a combination of expression/purification success, complex assembly, and functional assays as described in previous sections.

How can gene knockout and complementation studies inform our understanding of ndhC function?

Gene knockout and complementation studies provide powerful approaches to understand ndhC function in vivo. Complete deletion of ndhC can be achieved in T. elongatus using homologous recombination-based techniques, replacing the gene with a selectable marker. The resulting knockout strains can be phenotypically characterized for alterations in photosynthetic and respiratory capabilities, stress tolerance, and growth under various conditions.

Complementation studies involve reintroducing wild-type or modified ndhC genes into the knockout background, either at the native locus or at neutral genomic sites. This approach allows the assessment of which aspects of the wild-type phenotype can be restored by the reintroduced gene. By introducing specific mutations or chimeric constructs during complementation, the functional significance of particular domains or residues can be evaluated in vivo.

For rigorous analysis, complementation constructs should include the native promoter elements to ensure physiologically relevant expression levels. Alternatively, inducible promoter systems can be employed to control expression timing and levels, providing additional flexibility in experimental design and potentially revealing dosage-dependent phenotypes associated with ndhC function.

What are common challenges in working with recombinant ndhC and how can they be addressed?

Researchers working with recombinant ndhC from T. elongatus frequently encounter several challenges that require specific technical solutions:

Challenge 1: Low expression yields

  • Solution: Optimize codon usage for the expression host, employ specialized expression strains (C41/C43 for membrane proteins), and evaluate different fusion partners (MBP, SUMO) to enhance solubility.

  • Consider lower induction temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.2 mM) to favor proper folding over rapid expression.

Challenge 2: Protein aggregation during purification

  • Solution: Include appropriate detergents throughout purification (typically 0.03-0.05% n-dodecyl β-D-maltoside for solubilized membrane proteins).

  • Add stabilizing agents such as glycerol (10-15%) and ensure buffer pH and ionic strength are optimized for protein stability.

Challenge 3: Loss of native complex interactions

  • Solution: Consider co-expression with interacting partners or purification under mild conditions that preserve protein-protein interactions.

  • The one-step Ni²⁺ column chromatography approach used successfully for isolating intact NDH-1 complexes from T. elongatus strains represents an effective strategy for maintaining native interactions .

Challenge 4: Verifying proper folding and assembly

  • Solution: Employ analytical techniques such as circular dichroism to assess secondary structure, size exclusion chromatography to evaluate complex formation, and activity assays to confirm functional integrity.

Challenge 5: Thermal stability concerns

  • Solution: For proteins from thermophilic T. elongatus, maintain appropriate temperature conditions during purification and storage (typically 4°C for short-term, -80°C with cryoprotectants for long-term storage).

  • Consider thermal shift assays to identify buffer conditions that maximize protein stability.

How can researchers enhance the yield and stability of recombinant ndhC?

Enhancing the yield and stability of recombinant ndhC requires optimization at multiple stages of the experimental workflow:

Expression Optimization:

  • Evaluate different expression vectors with varying promoter strengths and regulatory elements

  • Test specialized E. coli strains designed for membrane protein expression (C41/C43)

  • Optimize growth media composition, potentially including osmolytes (betaine, sorbitol) that can enhance folding

  • Implement auto-induction systems for gentler, more controlled expression

Purification Enhancement:

  • Screen multiple detergents at various concentrations to identify optimal solubilization conditions

  • Include lipids during purification to stabilize the membrane protein environment

  • Add specific cofactors that may enhance stability (considering the NAD(P)H binding requirement)

  • Employ gradient purification techniques that minimize exposure to potentially destabilizing conditions

Storage Optimization:

  • Evaluate protein stability in various buffer systems using thermal shift assays

  • Test additives such as glycerol, sucrose, or specific lipids that may enhance long-term stability

  • Determine optimal protein concentration ranges to minimize aggregation during storage

  • Compare flash-freezing protocols versus storage at 4°C for maintaining functionality

When working with T. elongatus proteins specifically, leveraging the inherent thermostability of these proteins can provide advantages, as they often demonstrate enhanced resistance to denaturation compared to mesophilic homologs.

How can structural information about ndhC inform directed evolution experiments?

Structural information about ndhC within the NDH-1 complex provides crucial guidance for directed evolution experiments aimed at enhancing or modifying its functionality. By identifying catalytic residues, subunit interfaces, and conformational dynamics, researchers can design targeted libraries that focus mutagenesis on regions most likely to influence desired properties.

For directed evolution experiments, key considerations include:

  • Library Design Strategy: Focus on residues identified at functional interfaces based on structural data rather than random mutagenesis. Blue-native/SDS/PAGE analysis has already identified distinct NDH-1 complex forms (NDH-1L, NDH-1M, NDH-1S) , providing insights into potential structural regions of interest.

  • Screening Method Development: Design high-throughput assays specifically sensitive to NDH-1 activity, potentially using colorimetric detection of NAD(P)H oxidation or quinone reduction.

  • Selection Pressure Optimization: For in vivo evolution systems, create selection conditions that specifically advantage enhanced ndhC function, such as growth under conditions requiring efficient cyclic electron flow.

  • Recombination Approaches: Consider DNA shuffling or recombination techniques between successful variants to combine beneficial mutations, particularly focusing on thermostability and catalytic efficiency parameters.

The successful evolutionary engineering of ndhC could yield variants with enhanced electron transfer rates, altered substrate specificity, or improved stability under various environmental conditions, potentially leading to applications in bioenergy production or photosynthesis enhancement.

What potential applications exist for engineered ndhC variants in biotechnology?

Engineered ndhC variants hold significant potential for diverse biotechnological applications, particularly in systems leveraging photosynthetic or respiratory electron transfer processes:

  • Enhanced Photosynthetic Efficiency: Variants with improved cyclic electron flow capabilities could enhance ATP production without corresponding NADPH generation, potentially rebalancing the ATP:NADPH ratio for optimal carbon fixation under varying conditions.

  • Bioremediation Systems: Engineered NDH-1 complexes containing modified ndhC could potentially be employed in systems designed to degrade environmental pollutants through enhanced electron transfer to various acceptors.

  • Bioelectrochemical Applications: ndhC variants with altered quinone binding properties could be integrated into bioelectrochemical systems for improved electron transfer to electrodes in microbial fuel cells or biosensors.

  • Thermostable Enzyme Development: Leveraging the inherent thermostability of T. elongatus proteins, engineered ndhC variants could serve as components in industrial enzyme systems requiring robust performance at elevated temperatures.

  • CO₂ Capture Systems: Given the role of NDH-1 complexes in cyanobacterial CO₂ uptake mechanisms, engineered variants could potentially enhance carbon concentration and fixation capabilities, contributing to carbon capture biotechnologies.

The diverse functional roles of ndhC within electron transfer pathways make it a particularly versatile target for engineering efforts aimed at various biotechnological applications, especially those involving energy transduction processes.

What are the most promising research frontiers involving T. elongatus ndhC?

The study of ndhC from Thermosynechococcus elongatus presents several promising research frontiers that merit focused investigation:

  • High-Resolution Structural Determination: While blue-native/SDS/PAGE analysis has revealed the presence of distinct NDH-1 complex forms , high-resolution structural studies using cryo-EM would significantly advance our understanding of ndhC's position and interactions within these complexes.

  • Regulatory Mechanisms: Investigation of how environmental factors (light intensity, CO₂ availability, temperature) influence ndhC expression and NDH-1 complex assembly would provide valuable insights into the adaptive responses of T. elongatus.

  • Synthetic Biology Applications: Exploring the integration of ndhC or engineered variants into designer electron transport chains could lead to novel bioenergy systems with enhanced efficiency or specificity.

  • Comparative Studies Across Cyanobacterial Species: Systematic comparison of ndhC structure, function, and regulation across diverse cyanobacterial species could reveal evolutionary adaptations and conserved functional elements.

  • Integration with Artificial Photosynthetic Systems: Investigating how ndhC and associated NDH-1 complexes could interface with artificial photosynthetic components might lead to hybrid biological-synthetic systems with enhanced capabilities.

These research frontiers collectively promise to deepen our understanding of fundamental electron transport mechanisms while potentially yielding applications in renewable energy, carbon capture, and biotechnology.

How might systems biology approaches enhance our understanding of ndhC in the context of global electron transport?

Systems biology approaches offer powerful frameworks for understanding ndhC function within the broader context of cellular electron transport networks:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.