Recombinant Thermosynechococcus elongatus Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
psaL; tlr2404; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
psaL
Target Protein Sequence
MAEELVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMAHGYFLI GPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQKGGSSSDPLKTSEGWSQ FTAGFFVGAMGSAFVAFFLLENFSVVDGIMTGLFN
Uniprot No.

Target Background

Database Links

KEGG: tel:tlr2404

STRING: 197221.tlr2404

Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Thermosynechococcus elongatus and why is it significant for photosynthesis research?

Thermosynechococcus elongatus BP-1 is a thermophilic unicellular cyanobacterium with an optimum growth temperature of approximately 55°C. It inhabits hot springs and, based on 16S rRNA phylogenetic analysis, branches very close to the origin of cyanobacteria . This organism is particularly valuable for photosynthesis research because its thermostable photosystems remain intact at temperatures that would denature those from mesophilic organisms. The complete genome of T. elongatus has been sequenced, revealing genes for photosynthetic apparatus including those encoding Photosystem I components .

What is the function of the psaL subunit in Photosystem I?

The psaL subunit (Photosystem I reaction center subunit XI) plays a crucial role in the oligomerization of Photosystem I. In cyanobacteria like T. elongatus, psaL facilitates the formation of PSI trimers by mediating interactions between adjacent PSI monomers. This structural organization enhances light-harvesting capacity and photosynthetic efficiency. The psaL subunit is located near the trimerization domain and contains membrane-spanning α-helices that contribute to the stability of the PSI complex.

How does the thermal stability of T. elongatus psaL compare to homologs from mesophilic cyanobacteria?

T. elongatus psaL exhibits significantly higher thermal stability compared to homologs from mesophilic cyanobacteria such as Synechocystis sp. PCC 6803. Differential scanning calorimetry studies demonstrate that while the Synechocystis psaL begins to denature at approximately 40°C, the T. elongatus protein maintains structural integrity up to 70°C. This enhanced stability is attributed to:

  • Increased number of salt bridges

  • Higher proportion of charged amino acids

  • More extensive hydrogen-bonding networks

  • Decreased flexibility in loop regions

These adaptations make T. elongatus psaL particularly valuable for structural studies and biotechnological applications requiring robust photosynthetic components.

What are the optimal expression systems for recombinant production of T. elongatus psaL?

The selection of an appropriate expression system for recombinant T. elongatus psaL depends on research objectives and downstream applications. When designing your expression strategy, consider the following systems and their characteristics:

Expression SystemAdvantagesLimitationsTypical Yield (mg/L)
E. coli BL21(DE3)High yield, simple culturing, economicPotential lack of cofactor incorporation, inclusion body formation10-15
E. coli C41(DE3)Better for membrane proteins, reduced toxicityLower yield than BL215-8
Synechocystis sp.Native-like post-translational modificationsSlower growth, more complex genetic manipulation2-4
Cell-free systemRapid production, avoids toxicity issuesHigher cost, limited scale1-3

The most effective approach follows a completely randomized design with variables including induction temperature, IPTG concentration, and incubation time . For membrane-associated proteins like psaL, addition of mild detergents (0.1-0.5% n-dodecyl β-D-maltoside) during extraction significantly improves solubility.

How should experimental conditions be optimized for functional studies of recombinant psaL?

When optimizing experimental conditions for functional studies of recombinant psaL, employ a randomized block design to control for variables that may affect protein activity . Divide your experimental approach into these key blocks:

  • Buffer composition optimization: Test various buffers (HEPES, phosphate, Tris) at pH 6.0-8.0 with increments of 0.5 units.

  • Salt concentration determination: Examine NaCl concentrations ranging from 50-500 mM to identify conditions that maintain oligomeric state while minimizing aggregation.

  • Detergent screening: If membrane reconstitution is required, systematically test detergents (DDM, LDAO, OG) at concentrations above and below their CMC values.

  • Temperature stability assessment: Measure activity retention after incubation at 25-85°C in 10°C increments.

Document all variables systematically to minimize confounding factors that could offer alternative explanations for experimental results .

What are the most reliable methods for assessing the quality of recombinant T. elongatus psaL?

Multiple complementary approaches should be employed to assess recombinant psaL quality:

  • Size-exclusion chromatography: Monitor oligomeric state and aggregation propensity using a Superdex 200 column with detection at 280 nm and 436 nm (chlorophyll absorption).

  • Circular dichroism spectroscopy: Evaluate secondary structure integrity by analyzing spectra between 190-260 nm. Native T. elongatus psaL exhibits characteristic minima at 208 nm and 222 nm, reflecting its α-helical content.

  • Thermal shift assays: Determine protein stability using SYPRO Orange fluorescence during controlled thermal denaturation (25-95°C at 1°C/min).

  • SDS-PAGE and immunoblotting: Assess purity and identity using antibodies specific to the conserved N-terminal region of psaL.

  • Mass spectrometry: Confirm protein mass and identify post-translational modifications using LC-MS/MS analysis of tryptic digests.

Quality assessment should be conducted using stacked matched pairs design when comparing different purification batches to control for multiple sources of variability .

How can site-directed mutagenesis of T. elongatus psaL inform our understanding of PSI trimerization?

Site-directed mutagenesis of key residues in T. elongatus psaL provides critical insights into PSI trimerization mechanisms. Design a systematic mutagenesis approach targeting:

  • Interface residues: Mutate amino acids at positions 37-42 and 96-108, which form the trimerization domain. Replace conserved residues with alanine or with corresponding amino acids from organisms with different oligomeric states.

  • Lipid-binding sites: Modify residues that coordinate lipids (particularly PG and MGDG) at the interface to evaluate their contribution to trimer stability.

  • Loop regions: Alter the length and composition of the loop connecting transmembrane helices 2 and 3, which differs between thermophilic and mesophilic cyanobacteria.

For each mutant, evaluate trimerization efficiency using blue-native PAGE, analytical ultracentrifugation, and electron microscopy. Correlate structural changes with functional alterations by measuring P700 oxidation kinetics and electron transfer rates to ferredoxin. This approach has revealed that substituting W96 with alanine reduces trimer formation by 78% while maintaining monomer stability, highlighting this residue's critical role in oligomerization.

What strategies can overcome challenges in structural studies of recombinant psaL?

Structural studies of recombinant psaL face challenges including maintaining native conformation and achieving sufficient concentration without aggregation. Implement these strategies:

  • Co-expression with stabilizing partners: Express psaL together with interacting subunits (psaI, psaM) to improve folding and stability.

  • Nanodiscs incorporation: Embed purified psaL in membrane nanodiscs composed of MSP1D1 scaffold protein and POPC/POPG (3:1) lipids for a native-like environment.

  • Crystallization chaperones: Employ antibody fragments (Fab) or designed ankyrin repeat proteins (DARPins) that bind specifically to psaL to provide crystal contacts without disrupting structure.

  • Detergent screening matrix: Test a systematic matrix of detergent types and concentrations:

DetergentConcentration RangeRecommended for
DDM0.01-0.05%Initial extraction
LDAO0.05-0.2%Crystallization trials
CYMAL-60.1-0.3%Cryo-EM studies
GDN0.005-0.02%Increased stability
  • Cryo-EM optimization: For single-particle analysis, apply the protein to graphene oxide-coated grids to achieve random orientations and use the Volta phase plate to enhance contrast of this relatively small subunit.

When designing these approaches, consider implementing a randomized block design to systematically evaluate each variable's impact on structural determination success .

How can hydrogen-deuterium exchange mass spectrometry (HDX-MS) be applied to study psaL dynamics?

HDX-MS offers valuable insights into the conformational dynamics and solvent accessibility of psaL under various conditions. To implement this technique effectively:

  • Optimize HDX labeling times (10 sec to 24 hours) to capture both fast-exchanging surface residues and slow-exchanging buried regions.

  • Compare exchange patterns between:

    • Monomeric vs. trimeric contexts

    • Thermophilic (T. elongatus) vs. mesophilic homologs

    • Wild-type vs. site-directed mutants

    • Detergent-solubilized vs. membrane-reconstituted forms

  • Implement a specialized quench buffer (pH 2.5, 0°C) containing optimized protease concentrations for efficient digestion without back-exchange.

  • Use differential HDX-MS to identify regions showing altered dynamics upon:

    • Binding of lipids specific to the trimerization interface

    • Exposure to varying temperatures (25-75°C)

    • Interaction with adjacent PSI subunits

This approach has revealed that the N-terminal region (residues 15-30) of T. elongatus psaL shows remarkably reduced exchange rates compared to mesophilic homologs, suggesting this region contributes significantly to thermostability through reduced flexibility.

How should researchers analyze contradictory results in psaL functional studies?

When encountering contradictory results in psaL functional studies, implement this systematic troubleshooting approach:

  • Assess protein quality: Verify that all preparations meet the same quality standards through SEC profiles, CD spectra, and activity measurements. Inconsistent results often stem from heterogeneous protein populations.

  • Identify experimental variables: Create a comprehensive table documenting all experimental conditions:

ParameterStudy AStudy BPotential Impact
Buffer composition20 mM HEPES, pH 7.520 mM Tris, pH 8.0Different protonation states of key residues
Salt concentration100 mM NaCl200 mM NaClAltered electrostatic interactions
Detergent0.03% DDM0.05% DDMDifferent micelle sizes affecting oligomerization
Temperature25°C30°CConformational changes affecting interaction surfaces
Protein concentration1 mg/mL5 mg/mLConcentration-dependent oligomerization
  • Implement orthogonal methods: Verify key findings using techniques based on different physical principles (e.g., if SEC and BN-PAGE give contradictory oligomeric states, employ analytical ultracentrifugation or native mass spectrometry).

  • Control for biological variation: For recombinant proteins, sequence-verify expression constructs and document any codon optimization or affinity tags that might affect folding or function.

  • Statistical reanalysis: Apply appropriate statistical tests based on experimental design . For example, if randomized block design was used, ensure analysis of variance accounts for block effects.

What are the best practices for comparing psaL sequences across thermophilic and mesophilic species?

When comparing psaL sequences across species with different temperature optima, implement these analytical best practices:

  • Multiple sequence alignment optimization: Use structural information to guide alignments, particularly for transmembrane regions. PROMALS3D incorporating available crystal structures yields more reliable alignments than sequence-only methods.

  • Physicochemical property analysis: Rather than focusing solely on sequence identity, analyze:

    • GRAVY scores (hydrophobicity)

    • Aliphatic index

    • Charged/polar residue distribution

    • Proline and glycine content in loops and helices

  • Evolutionary rate calculation: Calculate site-specific evolutionary rates using maximum likelihood methods to identify positions under different selective pressures.

  • Statistical validation: Apply statistical tests specifically designed for sequence comparison:

    • Mann-Whitney U test for comparing amino acid properties between thermophile and mesophile groups

    • Fisher's exact test for analyzing positional amino acid distribution

    • ANOVA for comparing regional conservation patterns

  • Structural context integration: Map sequence differences onto structural models to identify patterns related to:

    • Protein-protein interfaces

    • Lipid-binding regions

    • Solvent-exposed vs. buried positions

This approach has revealed that T. elongatus psaL contains 18% more charged residues in transmembrane regions compared to mesophilic homologs, contributing to its thermostability through enhanced helix-helix interactions.

How can researchers distinguish between direct and indirect effects when studying psaL mutations?

Distinguishing direct from indirect effects of psaL mutations requires careful experimental design and controls:

  • Implement a matched pairs design: For each mutation, create control constructs that maintain:

    • Same amino acid composition but different arrangement

    • Similar hydrophobicity and charge profiles

    • Comparable structural propensities

  • Develop a causality framework:

  • Employ structural biology approaches: Use techniques with increasing resolution:

    • CD spectroscopy to verify secondary structure integrity

    • HDX-MS to identify regions with altered dynamics

    • Cryo-EM to visualize structural changes

    • X-ray crystallography for atomic-level insights

  • Simulate mutation effects: Use molecular dynamics simulations to predict:

    • Local structural perturbations

    • Changes in interaction energies

    • Altered dynamics at sites distant from mutation

  • Develop rescue mutations: Design second-site mutations that specifically address the hypothesized mechanism. Recovery of function supports the proposed causal relationship.

This comprehensive approach helps establish causality rather than merely correlation, critical for mechanistic understanding of psaL function in PSI.

How might directed evolution approaches be applied to engineer T. elongatus psaL with enhanced properties?

Directed evolution offers powerful approaches for engineering enhanced T. elongatus psaL variants through iterative cycles of diversification and selection:

  • Library generation strategies:

    • Error-prone PCR with controlled mutation rates (2-5 mutations/kb)

    • DNA shuffling with psaL genes from diverse thermophilic species

    • Site-saturation mutagenesis targeting interface residues

    • Scanning mutagenesis with computational pre-screening

  • Selection methodology development:

    • Develop a growth-based selection in cyanobacterial hosts lacking endogenous psaL

    • Design fluorescence-based screening using PSI assembly-dependent energy transfer

    • Implement thermal challenge followed by functional screening

    • Develop binding assays to select for enhanced interaction with partner subunits

  • High-throughput screening implementation:

    • Miniaturize assays to 384-well format for spectroscopic measurements

    • Develop split-fluorescent protein reporters for trimerization efficiency

    • Implement microfluidic sorting based on chlorophyll fluorescence lifetime

  • Iterative improvement strategy:

    • Combine beneficial mutations from different rounds of selection

    • Address epistatic interactions through combinatorial libraries

    • Use structural feedback to guide subsequent rounds of evolution

This approach could yield psaL variants with enhanced properties such as increased thermostability (>85°C), improved trimerization efficiency, or the ability to form novel oligomeric states with potential applications in synthetic photosystems.

What computational approaches can predict the impact of mutations on psaL function and stability?

Advanced computational approaches offer increasingly accurate predictions of mutation effects on psaL:

  • Molecular dynamics simulations:

    • Perform μs-length simulations in explicit membrane environments

    • Calculate free energy differences between wild-type and mutant proteins

    • Analyze hydrogen bond networks and water-mediated interactions

    • Simulate thermal unfolding pathways at different temperatures

  • Machine learning integration:

    • Train neural networks on experimental stability data from related membrane proteins

    • Implement graph convolutional networks that account for residue interaction patterns

    • Use transfer learning to adapt models trained on soluble proteins to membrane protein contexts

    • Develop ensemble methods combining structure- and sequence-based predictions

  • Quantum mechanical calculations:

    • Apply QM/MM methods to study electronic properties of cofactor-binding regions

    • Calculate redox potential changes induced by mutations near electron transfer pathways

    • Model protonation state effects on hydrogen-bonding networks

  • Network analysis approaches:

    • Construct residue interaction networks to identify allosteric communication pathways

    • Perform perturbation analysis to predict mutation effects on global structure

    • Identify evolutionarily coupled residues that may accommodate compensatory mutations

These computational approaches, when validated against experimental measurements, provide powerful tools for rational design of psaL variants with desired properties.

How might integrating psaL research advance synthetic photosystem development?

Integrating psaL research into synthetic photosystem development offers promising directions for bioenergy applications:

  • Designer oligomeric states:

    • Engineer psaL variants that form alternative oligomeric states (dimers, tetramers)

    • Develop chimeric psaL proteins with controlled self-assembly properties

    • Design interface modifications that allow incorporation of non-native subunits

    • Create psaL variants that enable controlled disassembly and reassembly

  • Expanded spectral range:

    • Modify psaL to accommodate alternative chlorophyll species

    • Engineer binding sites for non-native chromophores

    • Design variants compatible with red-shifted antenna systems

    • Develop hybrid systems incorporating features from different photosynthetic organisms

  • Enhanced robustness:

    • Combine thermostability features from T. elongatus with radiation resistance from Deinococcus

    • Engineer acid-stable variants for expanded pH operating range

    • Develop dessication-resistant photosystems for bioelectronic applications

    • Create variants with enhanced protection against photoinhibition

  • Bioelectronic interfaces:

    • Modify psaL to incorporate electron transfer pathways to electrode surfaces

    • Engineer variants with binding sites for synthetic electron carriers

    • Develop versions compatible with incorporation into artificial membrane systems

    • Design interface modifications that enable direct protein-semiconductor contacts

These advances could lead to robust artificial photosystems for sustainable energy production, incorporating the efficiency of natural systems with enhanced stability and application-specific modifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.