Recombinant Thermosynechococcus elongatus Photosystem II protein D1 1 (psbA1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

The D1 protein (psbA1) binds key cofactors, including P680 (the primary electron donor), phytol-terminated chlorophyll, pheophytin, and the oxygen-evolving Mn₄CaO₅ cluster . Its interactions with psbD2 (D2 protein) and other subunits form the reaction center heterodimer .

Functional Comparisons with psbA2 and psbA3

ParameterpsbA1-PSIIpsbA3-PSIISource
PheoD1 Redox Potential-522 mV-505 mV (+17 mV shift)
S₂QA⁻ Recombination RateSlower electron transfer ratesFaster rates due to altered QA environment
Herbicide BindingSingle bromoxynil binding siteTwo binding sites/conformations
Proton ReleaseEfficient Cl⁻/H⁺ transportSlower due to narrowed Cl⁻ channel

Gene Expression Under Stress

  • High Light (500 μmol m⁻² s⁻¹): psbA3 replaces psbA1 as the dominant mRNA isoform .

  • UV-B Exposure: Induces psbA3 and psbD2 transcripts .

  • Temperature (60°C): psbA1 becomes the sole psbA mRNA .

Protein Isoform Replacement

  • Kinetics: ~65% replacement of PsbA1 with PsbA3 after 2 hours of high-light acclimation .

  • Impact: Faster S₂QA⁻ charge recombination and altered thermoluminescence profiles .

Functional Modifications

MutationEffect on PSII FunctionalitySource
D1-Q130EAlters QA redox potential and S₂QA⁻ kinetics
D1-S153AModifies P680 redox potential
D1-S270AAffects QA pocket environment

Table 1: Amino Acid Differences Between PSII D1 Isoforms

Residue PositionpsbA1psbA2psbA3
Q130GlnGlnGlu
S153SerSerAla
S270SerSerAla
P173ProMetPro

Data synthesized from .

Table 2: Expression Conditions for psbA1 Dominance

ConditionpsbA1 DominanceSource
40°C, 40 μmol m⁻² s⁻¹~100%
60°C~100%
500 μmol m⁻² s⁻¹<35%

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
psbA1; psbA-1; tlr1843; Photosystem II protein D1 1; PSII D1 protein 1; Photosystem II Q(B protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
psbA1
Target Protein Sequence
MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFL LGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGF NFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H(2)O, producing O(2) and a proton gradient that is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Gene References Into Functions
  1. Based on experimental findings, it appears that His332(Gln, Ser) mutations of the D1 protein have no significant effect on the S2 state of the catalytic cycle. Mutant D1-His332 is more involved in the S3-state than in the S2-state. PMID: 19624137
Database Links

KEGG: tel:tlr1843

STRING: 197221.tlr1843

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of psbA genes in Thermosynechococcus elongatus?

Thermosynechococcus elongatus contains three psbA genes (psbA1, psbA2, and psbA3) that encode different variants of the D1 protein in Photosystem II. The psbA1 gene encodes the standard D1:1 form expressed under normal growth conditions, psbA3 encodes the D1:2 form that is induced under stress conditions such as high light, and psbA2 encodes a divergent D1' form that is weakly expressed under microaerobic conditions . This gene family organization is typical of cyanobacteria and allows for adaptive responses to varying environmental conditions .

How do the protein products of psbA1 and psbA3 differ structurally?

The amino acid sequence encoded by psbA3 differs from that encoded by psbA1 at 21 residue positions . One of the most significant differences is at position 130, where D1:1 (encoded by psbA1) has a glutamine (Q130) while D1:2 (encoded by psbA3) has a glutamate (E130) . This amino acid forms a hydrogen bond with pheophytin, a key electron transfer cofactor, and this substitution significantly affects the electron transfer properties of the protein . Additionally, structural studies have identified other key differences, such as the D1-Y147F exchange in PsbA2 that affects hydrogen bonding to pheophytin, and the D1-P173M substitution that impacts the organization of water molecules in the chloride channel .

What methodologies are available for quantifying the expression of different PsbA proteins?

Quantification of PsbA proteins has been challenging due to their high sequence homology. While transcript quantification using quantitative real-time PCR has been a standard method, protein-level quantification requires more sophisticated approaches. Researchers have successfully established a method based on reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS) to accurately quantify different PsbA proteins . This technique enables precise measurement of protein ratios in response to changing environmental conditions. For isotopic labeling studies, cultures can be grown in modified BG11 medium containing 15NH4Cl as the sole nitrogen source . This methodological advance allows researchers to correlate transcript and protein levels for the first time.

How do the energetics of electron transfer differ between PsbA1-containing and PsbA3-containing Photosystem II complexes?

Spectro-electrochemical measurements have demonstrated that the redox potential of pheophytin D1 (PheoD1) differs significantly between PsbA1-PSII and PsbA3-PSII. In PsbA1-PSII, PheoD1 has a redox potential of -522 mV, while in PsbA3-PSII, this value increases to -505 mV, representing a 17 mV positive shift . This shift is approximately half that observed with the D1-Q130E single site-directed mutagenesis in Synechocystis PCC 6803, suggesting that some of the additional amino acid changes in PsbA3 partially compensate for the Q130E substitution effects . Thermoluminescence and delayed fluorescence measurements of whole cells and isolated complexes confirm a shift in free energy between redox pairs in PsbA3 complexes compared to PsbA1 . These energetic differences contribute to the different functional properties of the two photosystems, particularly in their response to high light stress.

What experimental approaches are recommended for studying the differential functions of PsbA variants?

For comprehensive functional characterization of PsbA variants, a multi-technique approach is recommended:

  • Genetic manipulation: Construction of knock-out mutants that express only one PsbA variant. This can be achieved by replacing large parts of the target genes with antibiotic resistance cassettes (e.g., chloramphenicol for psbA1/psbA2 deletion or spectinomycin/streptomycin for psbA3 deletion) .

  • Protein quantification: Employ RP-LC-ESI-MS/MS for accurate protein quantification, especially during environmental transitions .

  • Functional assessment: Combine thermoluminescence, delayed fluorescence, and flash-induced fluorescence decay measurements to characterize electron transfer properties .

  • Photoinhibition studies: Expose cultures to high light (e.g., 500 μE m−2 s−1) followed by recovery under normal light to assess photoprotection capabilities .

  • Spectroscopic analysis: Study both whole cells and isolated PSII complexes using various spectroscopic techniques in the presence and absence of herbicides (e.g., DCMU, bromoxynil) to examine specific aspects of electron transfer .

These approaches allow detailed characterization at both cellular and molecular levels, providing insights into the specific adaptations conferred by each PsbA variant.

What molecular mechanisms underlie the enhanced photoprotection in PsbA3-containing Photosystem II complexes?

PsbA3-containing PSII complexes demonstrate superior photoprotection compared to PsbA1-containing complexes through several mechanisms:

  • Altered pheophytin redox potential: The more positive redox potential of pheophytin in PsbA3-PSII (shift from -522 mV to -505 mV) enhances the probability of harmless dissipation of excess energy .

  • Differential recovery from photoinhibition: Quantitative studies show that after high light exposure (500 μmol m−2 s−1 for 2 hours), Δ psbA3 mutants (containing only PsbA1) retain only 15-20% of active PSII centers with minimal recovery capacity, while Δ psbA1/psbA2 mutants (containing only PsbA3) maintain approximately 40% active centers with better recovery potential under normal light conditions .

  • Rapid protein turnover: Under high light conditions, there is a rapid shift in the PsbA pool, with PsbA3 reaching approximately 70-80% of both transcript and protein levels during continuous high light treatment, enabling efficient adaptation to stress conditions .

These mechanisms collectively contribute to the cell's ability to manage excess light energy and maintain photosynthetic efficiency under stressful conditions.

What culture conditions are optimal for studying differential expression of psbA genes in Thermosynechococcus elongatus?

For optimal studies of differential psbA gene expression, the following culture conditions are recommended:

  • Standard growth conditions: Liquid BG11 medium at 45°C, bubbled with CO2-enriched air, with light intensity at 50 μE m−2 s−1 .

  • High light induction: For studying PsbA3 induction, expose cultures to high light (500 μE m−2 s−1) for varying durations (1.5, 3, and 6 hours have been documented to show different expression patterns) .

  • Microaerobic conditions: For studying the weakly expressed PsbA2, create microaerobic conditions as described in specialized literature .

  • Mutant cultivation: For mutant strains, supplement the medium with appropriate antibiotics - chloramphenicol for Δ psbA1/psbA2 mutants and spectinomycin/streptomycin for Δ psbA3 mutants .

  • Isotopic labeling: For proteomic studies requiring isotopic labeling, grow cultures in modified BG11 medium containing 15NH4Cl as the sole nitrogen source .

Consistent maintenance of these conditions is crucial for reproducible results, especially when comparing expression patterns across different experimental conditions.

What are the key considerations for purifying active Photosystem II complexes containing specific D1 variants?

Purification of active PSII complexes containing specific D1 variants requires careful attention to several factors:

  • Starting material: Use genetically defined strains (e.g., knock-out mutants expressing only one PsbA variant) to ensure homogeneity of the purified complex .

  • Membrane preparation: Employ gentle cell disruption methods to maintain PSII integrity, followed by differential centrifugation to isolate thylakoid membranes.

  • Solubilization: Use appropriate detergents at optimized concentrations to solubilize the membrane complexes without disrupting the active PSII structure.

  • Chromatographic separation: Implement a combination of ion exchange and size exclusion chromatography to achieve high purity.

  • Quality control: Assess the activity and purity of isolated complexes through oxygen evolution measurements, absorption spectroscopy, and protein analysis techniques.

  • Storage conditions: Store purified complexes under conditions that maintain their stability and activity, typically at low temperatures in the presence of glycerol and appropriate buffers.

Successful purification enables detailed comparative studies of the structural and functional properties of PSII complexes containing different D1 variants.

How should researchers interpret differences in thermoluminescence and fluorescence data between PsbA1-PSII and PsbA3-PSII?

When analyzing thermoluminescence and fluorescence data from different PSII variants, researchers should consider the following interpretative framework:

By carefully analyzing these parameters, researchers can develop a comprehensive understanding of how specific amino acid substitutions affect the energetics and electron transfer dynamics in different D1 variants.

What comparative data exists on the photoinhibition resistance of PsbA1 versus PsbA3-containing Photosystem II complexes?

The following table summarizes key comparative data on photoinhibition resistance between PsbA1 and PsbA3-containing PSII complexes:

ParameterPsbA1-PSII (Δ psbA3 mutant)PsbA3-PSII (Δ psbA1/psbA2 mutant)Wild Type
Active PSII centers after 2h high light (500 μmol m−2 s−1)15-20%~40%~55%
Recovery under normal lightMinimalSignificantSubstantial
Pheophytin redox potential-522 mV-505 mVMixed
Expression under normal conditions~97%~3%Predominantly PsbA1
Expression after 6h high lightReducedIncreased to ~70-80%~70-80% PsbA3

This data clearly demonstrates that PsbA3-containing PSII complexes provide superior protection against photoinhibition, likely due to the altered redox potential of pheophytin that enables more efficient dissipation of excess energy . The wild type's ability to dynamically adjust the ratio of different D1 proteins in response to light conditions represents an important adaptation mechanism in Thermosynechococcus elongatus.

What are the current challenges in understanding the functional significance of the psbA gene family diversity?

Several challenges remain in fully understanding the functional significance of psbA gene family diversity:

  • Functional role of PsbA2: While PsbA1 and PsbA3 functions are increasingly well-characterized, the role of the divergent PsbA2 (D1') remains poorly understood. Its weak expression under microaerobic conditions suggests a specialized function that has not been fully elucidated .

  • Evolutionary significance: Understanding why cyanobacteria maintain multiple psbA genes while higher plants contain only one requires further comparative genomic and functional studies.

  • Regulatory mechanisms: The precise signaling pathways that control differential expression of psbA genes under various stress conditions need clarification.

  • Contribution of individual amino acid changes: With 21 amino acid differences between PsbA1 and PsbA3, determining which substitutions are most critical for functional differences remains challenging .

  • Environmental adaptation: How different psbA variants contribute to adaptation across diverse ecological niches remains to be fully explored.

Addressing these challenges will require integrated approaches combining molecular genetics, structural biology, biophysics, and ecological studies.

How might studying psbA1 in Thermosynechococcus elongatus contribute to engineering photosynthetic organisms for enhanced productivity?

Research on psbA1 and the psbA gene family in T. elongatus offers several potential applications for engineering enhanced photosynthetic organisms:

  • Stress tolerance engineering: Understanding how PsbA3 confers enhanced photoprotection could guide the development of crops with improved high light tolerance, potentially increasing productivity in high-light environments .

  • Dynamic protein exchange systems: The regulatory mechanisms controlling rapid PsbA exchange under changing conditions could inspire synthetic biology approaches for dynamic protein replacement in response to environmental cues.

  • Redox tuning: The altered redox properties associated with specific amino acid substitutions between PsbA variants could be exploited to optimize electron transfer efficiency in artificial photosynthetic systems .

  • Synthetic D1 variants: Combining beneficial features from different natural PsbA variants could lead to synthetic D1 proteins with enhanced properties for specific applications.

  • Cyanobacterial production platforms: Engineered T. elongatus strains with optimized photosynthetic machinery could serve as efficient platforms for the production of biofuels or high-value compounds.

By translating fundamental understanding of natural photosynthetic adaptations into applied engineering approaches, research on the psbA gene family has significant potential to contribute to the development of more productive and resilient photosynthetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.