Recombinant Thermosynechococcus elongatus Photosystem Q (B) protein 2

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Photosystem Q(B) Protein 2

The recombinant Photosystem Q(B) protein 2, encoded by the psbA2 gene in Thermosynechococcus elongatus, is a core component of Photosystem II (PSII), the enzyme responsible for light-driven water oxidation and oxygen evolution in cyanobacteria. This protein, also referred to as the D1 subunit, is critical for stabilizing the Mn₄CaO₅ cluster and facilitating electron transfer from the primary quinone acceptor (Qₐ) to the secondary quinone acceptor (Qᴮ). The recombinant version is produced in E. coli with an N-terminal His-tag for purification and structural studies .

PropertySpecification
Protein LengthFull-length (1–344 amino acids)
TagN-terminal His-tag
SourceThermosynechococcus elongatus (strain BP-1)
UniProt IDP0A446
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Purity>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C upon receipt; aliquot for long-term storage

Electron Transfer Pathways

  • Qₐ to Qᴮ Transfer: The semiquinone Qᴮ- ⁻ is stabilized thermodynamically, with midpoint potentials E(Qᴮ/Qᴮ- ⁻) ≈ 90 mV and E(Qᴮ- ⁻/QᴮH₂) ≈ 40 mV .

  • Proton Release: Slowed kinetics in PsbA2-PSII (vs. PsbA3-PSII) are linked to P173M substitution, narrowing the Cl⁻-1 channel and altering proton-coupled electron transfer .

  • TyrZ Oxidation: Altered hydrogen bonding in PsbA2-PSII prolongs P₆₈₀⁺ reduction kinetics (μs to ms range), impacting S-state transitions .

Comparative Analysis of PsbA1, PsbA2, and PsbA3

FeaturePsbA1PsbA2PsbA3
Key SubstitutionsC144P, P173MD1-Y147F, P173MQ130E, S270A
Midpoint PotentialE(PheoD1/PheoD1- ⁻) ≈ -522 mVE(PheoD1/PheoD1- ⁻) ≈ -505 mVE(PheoD1/PheoD1- ⁻) ≈ -505 mV
Proton Release KineticsFastSlowed (Cl⁻-1 channel)Fast
TyrZ EnvironmentStandard hydrogen bondingModified bonding (C144P)Standard

Data compiled from .

Applications in Research

  1. Electron Transfer Mechanisms: Studied using EPR spectroscopy (QA--Fe²⁺ signals) and thermoluminescence .

  2. Structural Biology: Crystallographic comparisons reveal subtle differences in quinone-binding pockets and Mn₄CaO₅ coordination .

  3. Mutagenesis Studies: Engineered mutants (e.g., D1-Y160F) enable isolation of TyrZ- and Mn₄CaO₅ signals for spectroscopic analysis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
psbA2; psbA-2; tlr1844; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
psbA2
Target Protein Sequence
MTTVLQRRQTANLWERFCDWITSTENRLYIGWFGVIMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITAAVVPSSNAIGLHLYPIWDAASLDEWLYNGGPYQLIIFHFL IGIFCYMGREWELSYRLGMRPWIPVAFSAPVAAATAVLLIYPIGQGSFSDGLMLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTETESTNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFAALGISTMAFNLNGF NFNHSVVDAQGNVINTWADIINRANIGIEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently utilized for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Gene References Into Functions
  1. Data suggest that in D1 proteins PsbA2-PSII and PsbA3/Pro173Met-PSII, the oxidation of TyrZ by P680+ was specifically slowed during the transition between S-states associated with proton release. PMID: 25193561
Database Links

KEGG: tel:tlr1844

STRING: 197221.tlr1844

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Thermosynechococcus elongatus and why is it important for photosynthesis research?

Thermosynechococcus elongatus is a thermophilic cyanobacterium that performs plant-type oxygenic photosynthesis and grows optimally at approximately 57°C . It has become a crucial model organism for photosynthesis research due to the remarkable thermal stability of its proteins, making them particularly suitable for biochemical, biophysical, and X-ray crystallographic studies . This thermostability has enabled groundbreaking structural analyses of photosynthetic reaction center protein complexes of photosystems I and II . The robustness of T. elongatus proteins allows researchers to purify, characterize, and crystallize them more easily than proteins from mesophilic organisms, advancing our understanding of fundamental photosynthetic mechanisms.

What role does the Q(B) protein 2 play in Photosystem II?

Photosystem Q(B) protein 2, also known as the D1 protein or the 32 kDa thylakoid membrane protein 2, serves as a critical component of Photosystem II (PSII) . The protein functions as a binding site for plastoquinone (PQ), which accepts electrons from Q(A) (the primary quinone acceptor) during photosynthetic electron transport . Specifically, the Q(B) site facilitates the two-step reduction of plastoquinone to plastohydroquinone (PQH₂), which is subsequently released into the membrane plastoquinone pool . This electron transfer process is fundamental to the water-splitting and oxygen-evolving functions of PSII, positioning the Q(B) protein as an essential component in converting light energy to chemical energy during photosynthesis.

What are the structural characteristics of recombinant T. elongatus Photosystem Q(B) protein 2?

Recombinant T. elongatus Photosystem Q(B) protein 2 consists of 344 amino acids with several key structural features :

  • Transmembrane domains: The protein contains multiple hydrophobic segments that anchor it within the thylakoid membrane .

  • Quinone binding pocket: The structure forms a specialized binding pocket that selectively binds plastoquinone with approximately 50 times higher affinity than plastohydroquinone .

  • Redox-active environment: The protein creates a specific environment that modifies the redox properties of bound quinones, establishing distinct midpoint potentials for the Q(B)/Q(B)- − and Q(B)- −/Q(B)H₂ redox couples .

  • Proton transfer pathway: The structure includes channels for proton transfer required for the formation of Q(B)H₂ after two sequential electron transfer events .

The full amino acid sequence of the protein (P0A446) contains regions critical for its function in electron transport and interaction with other PSII components .

How can site-directed mutagenesis be achieved in T. elongatus for studying Q(B) protein function?

Site-directed mutagenesis in T. elongatus can be achieved through a systematic genetic engineering approach that has been successful in modifying photosystem II components:

  • Target identification: Identify the specific genetic target, such as the psbA2 gene encoding the Q(B) protein .

  • Vector construction: Create a plasmid construct containing the desired mutation flanked by homologous sequences to facilitate recombination .

  • Transformation methodology: Transform T. elongatus with the constructed plasmid using natural transformation methods .

  • Selection strategy: Select transformants using appropriate antibiotic resistance markers, such as kanamycin resistance (Kmʳ) .

  • Verification approach: Confirm successful mutagenesis through PCR amplification using specific primers (e.g., eTS2-F4 and eTS2-R3) and sequencing of the targeted region .

This approach has been successfully used to create mutations such as D2-Y160F, where tyrosine 160 of the D2 protein was substituted with phenylalanine to eliminate the redox-active tyrosine Tyr D, enabling cleaner spectroscopic studies of the oxygen-evolving complex and associated radical species .

How do the redox properties of Q(B) differ from those of the plastoquinone pool?

The redox properties of Q(B) in T. elongatus Photosystem II exhibit significant differences from those of the free plastoquinone pool:

Redox CoupleMidpoint Potential (Em)Location
Q(B)/Q(B)- −~90 mVQ(B) site in PSII
Q(B)- −/Q(B)H₂~40 mVQ(B) site in PSII
Q(B)/Q(B)H₂ (average)~65 mVQ(B) site in PSII
PQ/PQH₂~117 mVMembrane pool

The approximately 50 mV difference between the average Q(B) potential (~65 mV) and the plastoquinone pool potential (~117 mV) represents a significant thermodynamic driving force for the release of PQH₂ to the pool . This energy difference is an essential feature that facilitates product release and maintains electron flow through PSII . Additionally, the relatively high potential of the Q(B)/Q(B)- − couple (~90 mV) contributes to the thermodynamic stability of the semiquinone intermediate, minimizing back-reactions and electron leakage to O₂ .

What factors influence the binding affinity of plastoquinone at the Q(B) site?

Several factors influence the binding affinity of plastoquinone at the Q(B) site in T. elongatus Photosystem II:

  • Redox state: The quinone form (PQ) binds approximately 50 times more tightly than the quinol form (PQH₂), a difference related to the ~50 mV energy gap between the Q(B)/Q(B)H₂ and PQ/PQH₂ redox couples .

  • Hydrogen bonding network: Specific amino acid residues form hydrogen bonds with the quinone, contributing to binding specificity and affinity .

  • Structural conformations: The Q(B) binding pocket undergoes subtle conformational changes during the electron transfer process that affect binding affinities .

  • Mutations: Site-directed mutations can alter the binding properties, as demonstrated in studies where changes in the hydrogen-bonding network affected quinone binding and electron transfer kinetics .

  • Environmental factors: pH and temperature can influence the protonation state of key residues in the binding pocket, affecting interactions with the quinone .

This preferential binding of the substrate (quinone) over the product (quinol) is crucial for PSII function, allowing efficient operation even when the plastoquinone pool is significantly reduced .

What spectroscopic techniques are most valuable for studying Q(B) function in T. elongatus?

Several spectroscopic techniques have proven particularly valuable for studying Q(B) function in T. elongatus PSII:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Directly detects the semiquinone radical (Q(B)- −) with high specificity

    • Enables measurement of redox potentials through equilibrium redox titrations

    • Allows observation of electron transfer intermediates without interference from Tyr D- in engineered mutants

  • Visible Spectroscopy:

    • Records difference spectra upon formation and reduction of the chlorophyll cation P680⁺

    • Detects structural perturbations in the hydrogen-bonding network affecting electron transfer

  • Fourier Transform Infrared (FTIR) Spectroscopy:

    • Monitors Q(B)- − formation upon illumination

    • Provides information about molecular vibrations and hydrogen-bonding interactions

  • Thermoluminescence:

    • Measures light emission from charge recombination reactions

    • The pH dependence provides estimates of the energy gap between Q(A)- − and Q(B)

These complementary techniques provide comprehensive insights into the structural and functional properties of Q(B) protein 2 in photosynthetic electron transport.

What are the optimal conditions for expressing and purifying recombinant T. elongatus Photosystem Q(B) protein 2?

Based on the available research, the optimal conditions for expressing and purifying recombinant T. elongatus Photosystem Q(B) protein 2 include:

  • Expression system:

    • Homologous expression in T. elongatus is preferred due to the complex membrane integration requirements

    • Transformation using natural transformation methods with targeting vectors containing appropriate selection markers

  • Growth conditions:

    • Temperature: 52-57°C (optimal growth temperature for T. elongatus)

    • Medium: BG-11 medium

    • Light conditions: Continuous light for initial growth

  • Purification approach:

    • His-tagging: Attachment of a His-tag to associated proteins facilitates purification of the PSII complex

    • Storage buffer: Tris-based buffer with 50% glycerol

    • Storage temperature: -20°C for short-term, -80°C for extended storage

    • Stability considerations: Avoid repeated freezing and thawing; working aliquots can be stored at 4°C for up to one week

  • Verification methods:

    • PCR confirmation of gene integration

    • Functional assays to verify proper electron transfer activities

These conditions should be optimized based on specific experimental objectives and the particular constructs being used.

How can the effect of Q(B) site mutations on PSII function be assessed methodologically?

Assessing the effects of Q(B) site mutations on PSII function requires a multi-faceted methodological approach:

  • Electron transfer kinetics:

    • Measure P680⁺ reduction kinetics using time-resolved spectroscopy

    • Monitor electron transfer from Q(A)- − to Q(B) using EPR or fluorescence decay measurements

    • Compare electron transfer rates between wild-type and mutant proteins

  • Redox potential determination:

    • Perform equilibrium redox titrations using EPR to detect Q(B)- − formation

    • Calculate midpoint potentials (Em) for the Q(B)/Q(B)- − and Q(B)- −/Q(B)H₂ couples

    • Compare potentials between wild-type and mutant proteins to evaluate thermodynamic changes

  • Oxygen evolution measurements:

    • Quantify oxygen evolution rates using oxygen electrodes

    • Assess the efficiency of enzyme function under various conditions

    • Determine if mutations affect the water-splitting capacity of PSII

  • S-state distribution analysis:

    • Monitor the distribution and lifetime of the S-states of the oxygen-evolving complex using EPR

    • Evaluate changes in S-state stability and transitions in mutants

  • Structural perturbation assessment:

    • Record difference spectra in visible and infrared regions

    • Identify changes in hydrogen-bonding networks or electrostatic properties

This comprehensive approach can reveal how specific mutations affect the structural and functional properties of the Q(B) binding site, providing insights into structure-function relationships in PSII.

How does the thermodynamic stability of Q(B)- − affect electron transfer efficiency in PSII?

The thermodynamic stability of the semiquinone Q(B)- − significantly impacts electron transfer efficiency in PSII through several mechanisms:

The thermodynamic properties of Q(B)- − represent an evolutionary optimization that balances energy conservation with the need for reliable electron transfer in photosynthetic systems.

What insights does the preferential binding of quinone over quinol provide for PSII functioning in vivo?

The approximately 50-fold higher binding affinity of quinone (PQ) compared to quinol (PQH₂) at the Q(B) site provides several important insights into PSII functioning in vivo:

  • Operation in reduced plastoquinone pool:

    • PSII can continue functioning efficiently even when the plastoquinone pool is significantly reduced

    • This is crucial during high light conditions or when downstream electron transport is limited

    • The preferential binding of PQ ensures substrate availability under various physiological conditions

  • Product release facilitation:

    • The lower binding affinity for PQH₂ provides a mechanism for efficient product release

    • This prevents product inhibition that would occur if reduced quinol remained tightly bound

    • The ~50 mV energy difference between Q(B)/Q(B)H₂ and PQ/PQH₂ couples provides thermodynamic driving force for PQH₂ release

  • Evolutionary conservation:

    • Similar binding preferences have been observed in purple bacterial reaction centers, suggesting evolutionary conservation of this feature

    • This conservation highlights the fundamental importance of appropriate binding affinities for efficient photosynthetic electron transport

  • Energy economy:

    • The binding preference represents an optimization that balances energy conservation with operational efficiency

    • While the energy difference for PQH₂ release represents an energy cost, it ensures continuous electron flow through PSII

This binding regime illustrates how PSII has evolved to optimize function under varying environmental conditions while maintaining efficient energy conversion.

How might structure-based protein engineering be used to modify Q(B) properties for enhanced photosynthetic efficiency?

Structure-based protein engineering of the Q(B) binding site offers several promising strategies for enhancing photosynthetic efficiency:

These engineering approaches, guided by the detailed structural and functional understanding of the Q(B) binding site in T. elongatus, could contribute to developing photosynthetic systems with enhanced efficiency and environmental resilience.

How does circadian regulation affect Q(B) protein expression and function in T. elongatus?

Circadian regulation significantly impacts Q(B) protein expression and function in T. elongatus through multiple mechanisms:

  • Gene expression patterns:

    • The psbA genes, which encode the D1 protein containing the Q(B) binding site, exhibit circadian expression patterns

    • This temporal regulation can be monitored using bioluminescence reporter systems with the psbA1 promoter fused to bacterial luciferase genes (luxAB)

    • Expression rhythms persist across a wide temperature range (30-60°C), indicating robust circadian control

  • Protein synthesis coordination:

    • Circadian regulation coordinates the synthesis of PSII components, including the Q(B) protein, with anticipated light availability

    • This temporal organization may optimize the stoichiometry of photosynthetic complexes throughout the day-night cycle

  • Genetic basis:

    • The circadian clock in T. elongatus is regulated by the kaiABC gene cluster, which shows high homology with corresponding genes in other cyanobacteria

    • The three-dimensional structure of clock proteins from T. elongatus has been determined, providing insights into the molecular mechanisms regulating photosynthetic gene expression

  • Methodological approaches for studying circadian effects:

    • Bioluminescence monitoring systems using the psbA1 promoter region fused to the Xl luxAB gene set

    • For temperatures below 41°C: Monitoring from single colonies on solid medium

    • For temperatures 55-60°C: Monitoring from liquid cultures due to reporter instability at high temperatures

Understanding these circadian influences on Q(B) protein expression and function provides insights into the temporal organization of photosynthesis and may inform strategies for optimizing photosynthetic efficiency across diurnal cycles.

What comparative insights can be gained from studying Q(B) energetics in T. elongatus versus other photosynthetic organisms?

Comparative analysis of Q(B) energetics between T. elongatus and other photosynthetic organisms reveals important evolutionary patterns and functional principles:

  • Conservation of energetic relationships:

    • The energetics of Q(B) in T. elongatus PSII are comparable to those in homologous purple bacterial reaction centers, suggesting evolutionary conservation of these energy relationships

    • This conservation highlights the fundamental importance of appropriate Q(B) energetics for efficient photosynthetic electron transport across diverse photosynthetic organisms

  • Thermostability adaptations:

    • T. elongatus has evolved Q(B) function that remains stable and efficient at temperatures up to approximately 60°C

    • Comparing the structural features that confer this thermostability with mesophilic counterparts can reveal adaptation mechanisms

    • These adaptations may involve specific amino acid substitutions or structural reinforcements that maintain proper Q(B) function at high temperatures

  • Differences in redox potentials:

    • Comparing the midpoint potentials of Q(B) redox couples across species can reveal adaptations to different ecological niches

    • Variations in the energy gap between Q(A)- − and Q(B) may reflect different optimizations of the balance between driving force and energy conservation

  • Research methodologies across systems:

    • Techniques developed for studying Q(B) in one system can often be adapted for others

    • EPR approaches used in T. elongatus have parallels in studies of purple bacterial reaction centers

    • Mutagenesis strategies can be compared across systems to identify conserved functional residues

These comparative insights not only enhance our understanding of photosynthetic evolution but also inform biomimetic approaches to designing artificial photosynthetic systems with improved efficiency and environmental resilience.

How might the unique properties of T. elongatus Q(B) protein be harnessed for biotechnological applications?

The unique properties of T. elongatus Q(B) protein, particularly its thermostability and efficient electron transfer characteristics, offer several promising biotechnological applications:

  • Biohybrid solar cells:

    • The thermostable Q(B) protein could be incorporated into biohybrid devices for solar energy conversion

    • Its optimized redox properties could facilitate efficient electron transfer to electrodes

    • The thermal resilience would enhance durability and performance under variable temperature conditions

  • Biosensors:

    • The Q(B) binding site could be engineered to detect specific molecules that modulate electron transfer

    • Changes in electron transfer efficiency could provide quantifiable signals for analyte detection

    • The thermostability would enable biosensor deployment in harsh environments

  • Biocatalysis:

    • The electron transfer capabilities could be harnessed for redox biocatalysis applications

    • Engineering the Q(B) site to accept alternative electron acceptors could create novel biocatalytic pathways

    • The thermostability would allow biocatalytic processes to operate at elevated temperatures, potentially increasing reaction rates and reducing contamination risks

  • Bioelectronic interfaces:

    • The well-characterized redox properties could facilitate integration with electronic components

    • Immobilized Q(B) protein could serve as a biological-electronic interface in biocomputing applications

  • Model systems for protein engineering:

    • The extensive structural and functional characterization of T. elongatus Q(B) protein provides a valuable model for designing enhanced photosynthetic systems

    • Insights from its thermostability could inform strategies for engineering heat-resistant proteins for various applications

These applications leverage the unique combination of thermostability, well-defined redox properties, and efficient electron transfer capabilities that characterize the T. elongatus Q(B) protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.