Recombinant Thermosynechococcus elongatus Photosystem Q (B) protein 3 (psbA3)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Biological Role

Recombinant Thermosynechococcus elongatus Photosystem Q(B) Protein 3 (PsbA3) is a genetically engineered variant of the D1 subunit of Photosystem II (PSII), produced to study its structural and functional properties. PsbA3 is one of three D1 isoforms encoded by the psbA gene family in T. elongatus, differing from PsbA1 and PsbA2 by 21 and 27 amino acids, respectively . This protein is critical for PSII's electron transport chain, facilitating water oxidation and plastoquinone (Q(B)) binding .

Key substitutions in PsbA3 compared to PsbA1:

PositionPsbA1 ResiduePsbA3 ResidueFunctional Impact
130Gln (Q)Glu (E)Modulates PheophytinD1 (PheoD1) redox potential
147Tyr (Y)Phe (F)Alters hydrogen bonding to PheoD1
173Pro (P)Met (M)Affects Cl⁻ channel geometry

These substitutions influence PSII’s redox properties and proton-coupled electron transfer dynamics .

A. Redox Properties

  • PheoD1 midpoint potential: Increased by 17 mV in PsbA3-PSII (-505 mV) compared to PsbA1-PSII (-522 mV) .

  • Thermoluminescence: S₂Qₐ⁻- charge recombination in PsbA3-PSII occurs at ~18°C vs. ~32°C in PsbA3/E130Q mutants .

B. Electron Transfer Kinetics

  • TyrZ oxidation: Slower P680⁺- reduction in PsbA2-PSII (ms range) vs. PsbA3-PSII (μs range) .

  • Proton release: PsbA3-PSII exhibits optimized Cl⁻ channel dynamics due to Pro173→Met substitution .

C. Environmental Adaptation

  • PsbA3 expression is induced under high-light or UV stress, enhancing PSII’s resistance to photodamage .

Comparative Analysis with Other D1 Variants

FeaturePsbA1-PSIIPsbA3-PSIIPsbA2-PSII
PheoD1 Em (mV)-522 -505 -510
Q(B) Exchange RateModerate High Low
Dominant ConditionsLow-light High-light Micro-aerobic

Applications in Research

  1. Mechanistic Studies: Used to dissect proton-coupled electron transfer pathways in PSII .

  2. Oxidative Stress Models: PsbA3-PSII’s resilience to singlet oxygen (¹O₂) informs photoprotection strategies .

  3. Biotechnology: Engineered PSII complexes for bioenergy applications .

Key Research Findings

  • The Glu130→Gln substitution in PsbA3 stabilizes PheoD1⁻- , reducing charge recombination and ¹O₂ production .

  • Crystal structures reveal PsbA3-PSII has a unique hydrogen-bonding network around PheoD1, absent in PsbA2-PSII .

  • PsbA3-PSII’s Cl⁻ channel geometry enhances proton release efficiency under high-light conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA3; tlr1477; Photosystem II protein D1 3; PSII D1 protein 3; Photosystem II Q(B protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
psbA3
Target Protein Sequence
MTTVLQRREQLNLWEQFCSWVTSTNNRLYVGWFGVLMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFL IGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETTETESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNHSVVDAQGNVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Gene References Into Functions
  1. The Gln130 mutation in this study had minimal impact on water splitting, charge accumulation, and photosensitivity but did slow down S2QA(-) charge recombination and upshift the thermoluminescence while increasing its yield. PMID: 24060528
Database Links

KEGG: tel:tlr1477

STRING: 197221.tlr1477

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is psbA3 and what is its functional role in photosynthesis?

psbA3 encodes one of the three D1 protein isoforms (PsbA3) in the cyanobacterium Thermosynechococcus elongatus. The D1 protein is a core component of Photosystem II (PSII), critical for photosynthetic electron transport. Specifically, PsbA3 contains 344 amino acids and functions as the Q(B) protein, serving as the secondary electron acceptor in PSII .

The PsbA3 protein plays a vital role in electron transfer during photosynthesis, particularly in high light conditions. Studies have shown that PsbA3 complexes provide better protection against photoinhibition compared to PsbA1 complexes due to a higher probability of harmless dissipation of excess energy . This adaptation is crucial for the organism's survival under varying light intensities.

How does PsbA3 differ from other D1 isoforms in T. elongatus?

PsbA3 differs from other D1 isoforms (PsbA1 and PsbA2) through specific amino acid variations:

ComparisonNumber of Different Amino AcidsKey Functional Differences
PsbA1 vs. PsbA321Different redox potentials of pheophytin
PsbA1 vs. PsbA231Not fully characterized
PsbA2 vs. PsbA327Not fully characterized

Among the critical differences, the glutamate at position 130 (Glu130) in PsbA3 versus a glutamine (Gln130) in PsbA1 causes a significant shift in the redox potential of pheophytin toward more positive values . This modification affects the energy distribution in PSII and contributes to differences in photoinhibition resistance.

What expression systems are used for recombinant psbA3 protein production?

Recombinant PsbA3 protein is typically expressed in E. coli systems. The full-length protein (1-344 amino acids) can be produced with various tags to facilitate purification, with His-tagging at the N-terminus being a common approach . The expression in E. coli provides sufficient yields for structural and functional studies while maintaining proper protein folding.

How can I design experiments to compare different psbA isoforms?

To effectively compare psbA isoforms, consider implementing the following experimental design approach:

  • Generate specific knockout mutants: Create T. elongatus strains lacking specific psbA genes (e.g., ΔpsbA1/psbA2 or ΔpsbA3) using targeted gene deletion strategies .

  • Control environmental variables: Maintain consistent growth conditions across experiments, with specific variations only in target parameters (light intensity, temperature).

  • Apply single-subject experimental design principles: Use approaches where individuals serve as their own controls with repeated measures to ensure reliable comparisons .

  • Implement verification and replication: Confirm results through multiple independent experiments and biological replicates to ensure reproducibility.

  • Combine whole-cell and isolated complex analyses: Compare results from both whole cells and isolated PSII complexes to gain comprehensive insights into functional differences .

What methods are most effective for quantifying psbA protein levels?

The most reliable method for quantifying PsbA proteins is reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS) . This approach overcomes the challenge of high sequence identity between the three PsbA copies, which previously made protein quantification difficult.

Implementation protocol:

  • Extract and purify total protein from cells

  • Perform tryptic digestion

  • Analyze peptide fragments using RP-LC-ESI-MS/MS

  • Identify unique peptide markers for each PsbA isoform

  • Quantify relative abundance based on peptide signal intensity

This method has revealed that upon high light incubation, approximately 70% PsbA3 can be detected, which closely corresponds to transcript levels observed in previous studies .

How can I properly express and purify recombinant PsbA3 protein?

For optimal expression and purification of recombinant PsbA3:

  • Expression system: Use E. coli with appropriate expression vectors containing N-terminal His-tag .

  • Purification protocol:

    • Harvest cells and resuspend in Tris/PBS-based buffer

    • Lyse cells through sonication or mechanical disruption

    • Purify using Ni-NTA affinity chromatography

    • Perform buffer exchange to remove imidazole

    • Concentrate and store as lyophilized powder

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

  • Reconstitution procedure:

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) for long-term storage

    • Default final concentration of glycerol is typically 50%

How do the redox properties of PsbA3 affect electron transfer in Photosystem II?

The redox properties of PsbA3 significantly influence electron transfer dynamics in PSII. PsbA3 contains glutamate at position 130 (E130) instead of glutamine (Q130) found in PsbA1, which alters the hydrogen bonding network to pheophytin (PheoD1) .

This amino acid substitution shifts the redox potential of the PheoD1/PheoD1-- couple toward more positive values, resulting in:

  • A change in the free energy between redox pairs detectable by thermoluminescence and delayed fluorescence measurements

  • An upshift in peak temperature of glow curves by approximately 14°C (from ≈18°C in PsbA3-PSII to ≈32°C in PsbA3/E130Q)

  • Better protection against photoinhibition due to a higher probability of harmless dissipation of excess energy

Interestingly, despite these significant changes in redox potential, no differences in the QA-QB electron transfer have been observed in flash-induced fluorescence decay or prompt fluorescence measurements , suggesting compensatory mechanisms in the electron transport chain.

What molecular mechanisms govern quinone exchange in PSII containing PsbA3?

The molecular mechanism of quinone exchange in PSII containing PsbA3 involves several structural transformations and water-mediated processes:

  • Conformational changes: The release of QB leads to the transformation of the short helix (D1-Phe260 to D1-Ser264) into a loop, which is adjacent to the stromal helix de (D1-Asn247 to D1-Ile259) .

  • Water-intake channel formation: This conformational change creates a water-intake channel connecting the QB binding pocket and the protein bulk surface .

  • H-bond network establishment: Water molecules enter the QB binding pocket via this channel and form a hydrogen bond network that serves as a proton-transfer pathway .

  • Protonation mechanisms: The H-bond network facilitates reprotonation of D1-His215, which acts as the proton donor during QBH−/QBH2 conversion .

These mechanisms differ from those in photosynthetic reaction centers from purple bacteria (PbRC), which lack the corresponding short helix but contain Glu-L212, suggesting evolutionary divergence in quinone exchange strategies between different photosynthetic organisms .

How do single point mutations affect PsbA3 function in redox potential regulation?

Single point mutations in PsbA3, particularly at position 130, have profound effects on redox potential regulation:

  • The E130Q mutation in PsbA3 shifts the redox potential of pheophytin, affecting the energy distribution in PSII .

  • This shift alters the free energy gap between the primary radical pair P680+- Pheo−- and the secondary radical pair P680+- QA−- .

  • The magnitude of this effect in T. elongatus is complicated by the presence of 20 other amino acid differences between PsbA1 and PsbA3, which may partially compensate for the redox potential changes .

  • Comparative studies with Synechocystis 6803 (Q130E mutation) and Chlamydomonas reinhardtii (E130Q mutation) show that the isolated point mutations in these organisms have more pronounced effects on S2QA−- charge recombination rate and thermoluminescence properties than in T. elongatus .

This suggests a complex interplay between multiple amino acid residues in fine-tuning the redox properties of PSII, highlighting the importance of considering the entire protein context when analyzing single mutations.

How can I resolve contradictory data when analyzing psbA3 functional characteristics?

When facing contradictory data in psbA3 research, implement this systematic approach:

  • Verify experimental conditions: Ensure consistent growth conditions, light intensities, and temperature across experiments, as these factors significantly influence psbA expression .

  • Confirm strain genotypes: Validate knockout strains through PCR amplification and sequencing of mutated regions. For example, use primers like P3 (5′-GGCTGGTTCGGCGTGTTGATGATCCCCACT-3′) and P4 (5′-AACCGTAGTTGCAGATTCGGTTTCGGTGG-3′) to confirm psbA3 mutations .

  • Use multiple analytical techniques: Combine complementary methods such as:

    • Thermoluminescence and delayed fluorescence for energy gap assessment

    • Flash-induced fluorescence decay for electron transfer kinetics

    • MS-based protein quantification for expression levels

  • Isolate variables: When comparing PsbA isoforms, create single point mutations to isolate effects of individual amino acid changes from the collective influence of multiple variations .

  • Consider experimental design limitations: Apply appropriate quasi-experimental design frameworks when randomization is not possible, using time series analysis or non-equivalent dependent variables approaches .

What are the key experimental controls needed when studying recombinant PsbA3?

Essential experimental controls for recombinant PsbA3 research include:

  • Expression controls:

    • Empty vector control to account for host cell background

    • Wild-type protein expression for comparison with mutant variants

    • Housekeeping protein expression to normalize loading and expression efficiency

  • Purification controls:

    • Protein purity verification by SDS-PAGE (>90% purity)

    • Western blot analysis with anti-His antibodies to confirm identity

    • Mass spectrometry validation of protein integrity

  • Functional controls:

    • Comparison with native protein isolated from T. elongatus

    • Parallel analysis of PsbA1-containing PSII complexes

    • Temperature stability assessments relevant to thermophilic origin

  • Experimental design controls:

    • Double pretest designs for time-series measurements

    • Include nonequivalent dependent variables when using pretest-posttest designs

    • Implement repeated measures with subjects serving as their own controls

  • Storage stability controls:

    • Fresh protein preparation compared with stored preparations

    • Monitoring activity over time under different storage conditions

    • Testing for aggregation or degradation products

How should I interpret differences in electron transfer kinetics between PsbA isoforms?

When interpreting electron transfer kinetic differences between PsbA isoforms, consider:

  • Energy gap analysis: Differences in thermoluminescence peak temperatures directly reflect changes in the free energy gap between radical pairs. For example, the ≈14°C upshift observed with E130Q mutation corresponds to a specific shift in the redox potential of the PheoD1/PheoD1−- couple .

  • Functional implications: PsbA3 complexes showing equal QB-QA electron transfer rates but different pheophytin redox potentials suggest a protective mechanism specifically against high light damage rather than a general change in electron transport efficiency .

  • Evolutionary context: Compare results with homologous systems in other organisms (e.g., Synechocystis 6803, Chlamydomonas reinhardtii) to distinguish conserved mechanisms from species-specific adaptations .

  • Integration with transcriptional data: Correlate protein function with expression patterns. For instance, the induction of psbA3 under high light conditions aligns with its protective role against photoinhibition .

This integrative interpretation approach provides a comprehensive understanding of how structural differences translate to functional adaptations in photosynthetic electron transport.

What emerging techniques show promise for advanced psbA3 research?

Several cutting-edge techniques show significant promise for advancing psbA3 research:

  • Cryo-electron microscopy (cryo-EM): Enables high-resolution structural analysis of PSII complexes containing different PsbA isoforms without crystallization requirements .

  • Time-resolved spectroscopy: Captures electron transfer events at femtosecond to millisecond timescales, allowing detailed kinetic analysis of differences between PsbA variants.

  • Single-molecule techniques: Provides insights into conformational dynamics and heterogeneity of individual PSII complexes under various light conditions.

  • CRISPR/Cas9 genomic editing: Facilitates precise manipulation of psbA genes for studying specific amino acid contributions to protein function in vivo.

  • Computational approaches: Molecular dynamics simulations and quantum mechanical/molecular mechanical (QM/MM) calculations help elucidate mechanisms of quinone exchange and proton transfer pathways .

  • Multi-omics integration: Combines transcriptomics, proteomics, and metabolomics to understand system-level responses to different light conditions and how they relate to psbA isoform expression and function.

These emerging techniques will help resolve remaining questions about the molecular mechanisms underlying the functional differences between PsbA isoforms and their physiological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.