Recombinant Thermosynechococcus elongatus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Thermosynechococcus elongatus lgt

Thermosynechococcus elongatus Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme identified in the thermophilic cyanobacterium Thermosynechococcus elongatus strain BP-1 . The protein is encoded by the lgt gene, with the ordered locus name tll2157 in the bacterial genome . According to database entries, the enzyme has been assigned the Enzyme Commission (EC) number 2.4.99.-, placing it in the transferase class of enzymes that catalyze glycosyl group transfers . The full-length protein from T. elongatus spans an expression region of 1-268 amino acids and is cataloged in the UniProt database under the accession number Q8DH03 .

Thermosynechococcus elongatus BP-1 is notable as a thermophilic cyanobacterium, with improved genetic transformation techniques enhancing its utility in recombinant protein research. The transformation efficiency has been significantly increased through a combination of electroporation and top agar methods, with further improvements observed when using disruption of putative type I restriction endonuclease (tll2230) in recipient cells . This technological advancement has facilitated the production and study of recombinant proteins from this organism, including lgt.

Role in Bacterial Lipoprotein Processing

The lgt enzyme occupies a pivotal position in bacterial lipoprotein biosynthesis, catalyzing the first and committed step in the post-translational lipoprotein modification pathway . Within this pathway, lgt transfers a diacylglyceryl (DAG) moiety from phosphatidylglycerol onto a conserved cysteine residue in target preprolipoproteins, forming a thioether-linked prolipoprotein . This modification is critical for proper anchoring of lipoproteins to the bacterial cell membrane.

The lipoprotein processing pathway continues after lgt-mediated modification with the action of signal peptidase II (Lsp), which cleaves the signal peptide, followed by apolipoprotein N-acyltransferase (Lnt) that adds a third acyl group to produce mature triacylated lipoproteins . This pathway is largely conserved across bacterial species, though variations exist, particularly in the final acylation step.

Essential Amino Acid Residues

Detailed mutagenesis studies have identified multiple essential residues in lgt proteins that are critical for enzymatic function. Among the 22 lgt proteins from pathogenic species analyzed, 16 residues were found to be completely conserved, highlighting their fundamental importance for enzyme activity . Experimental evidence from complementation studies has categorized these residues based on their impact on lgt function when mutated to alanine.

The following table summarizes key functional residues identified in lgt proteins:

ResidueDomain LocationEffect of MutationFunctional Impact
Y26Transmembrane-1Y26A prevents growthEssential
G98Between arm-2 and TM-3G98A causes delayed growthImportant
G104Transmembrane-3G104A causes delayed growthImportant
R143Transmembrane-4R143A prevents growthEssential
N146Transmembrane-4N146A prevents growthEssential
E151Loop between TM-4 and headE151A causes delayed growthImportant
G154Loop between TM-4 and headG154A prevents growthEssential
R239Transmembrane-6R239A prevents growthEssential
D129Not specifiedD129A allows normal growthNon-essential
E243Not specifiedE243A allows normal growthNon-essential

These findings provide valuable insights into the structure-function relationship of lgt proteins and may guide the development of targeted inhibitors with potential antimicrobial applications .

Domain-Specific Functions

The arm and head domains of lgt have emerged as regions of particular interest in understanding enzyme function. Complementation experiments with chimeric proteins containing head domains from different bacterial species demonstrated that the periplasmic head domain is crucial for lgt activity . For instance, chimeric constructs with head domains from Mycobacterium tuberculosis or Staphylococcus aureus showed impaired ability to restore viability in lgt-depleted E. coli strains, exhibiting abnormal cell morphology and reduced growth .

Applications in Research

As a recombinant protein with enzyme activity, Thermosynechococcus elongatus lgt serves multiple purposes in biochemical and microbiological research. Its thermostable nature, derived from the thermophilic host organism, makes it particularly valuable for applications requiring heightened temperature stability. The protein can be employed in enzyme-linked immunosorbent assays (ELISA), as indicated by its commercial availability as an ELISA reagent .

Beyond its use in immunological assays, the recombinant protein provides a tool for investigating the mechanisms of bacterial lipoprotein processing, enabling researchers to elucidate the structural determinants of enzyme activity and substrate specificity. Furthermore, as lgt represents a potential target for novel antibiotics due to its essentiality in many bacterial species, the recombinant protein offers opportunities for inhibitor screening and drug development studies .

Evolutionary Conservation and Divergence

The lgt protein has been identified as present across all bacterial species examined, while being consistently absent from archaeal genomes . This universal bacterial distribution underscores its fundamental importance in bacterial physiology. Computational analyses using AlphaFold have generated structural models of lgt proteins from various species, revealing structural similarities to the experimentally determined X-ray structure of E. coli lgt .

Functional Complementation Studies

The functional implications of these structural variations have been investigated through complementation studies, where lgt proteins from different bacterial species were expressed in E. coli strains depleted of endogenous lgt. These experiments revealed that lgt proteins from proteobacteria, but not from firmicutes, could restore growth and viability in the lgt-depleted E. coli strain .

Interestingly, even within proteobacteria, variations in complementation efficiency were observed. For example, while most proteobacterial lgt proteins fully restored growth, the lgt from Neisseria gonorrhoeae showed reduced efficiency in solid media growth assays . These findings suggest evolutionary adaptations that may tailor lgt activity to specific bacterial physiological contexts or substrate profiles.

Future Research Directions and Significance

The study of Recombinant Thermosynechococcus elongatus Prolipoprotein diacylglyceryl transferase continues to offer promising avenues for both basic and applied research. As lgt represents the first and committed step in bacterial lipoprotein processing, understanding its mechanism and regulation provides insights into fundamental aspects of bacterial cell envelope biogenesis.

Furthermore, the essentiality of lgt for viability in proteobacteria, combined with its membrane localization and relative accessibility, positions it as a promising target for the development of novel antibiotics . The identification of conserved functional residues and domains through structural and mutational analyses provides a foundation for targeted drug design approaches.

The thermostable nature of Thermosynechococcus elongatus lgt adds another dimension to its research value, potentially offering enhanced stability in biotechnological applications that require robust enzymatic activity under challenging conditions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lgt; tll2157; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
lgt
Target Protein Sequence
MIAAFQSPGATLELGFITLRWYGLLIAVAVFIGIWLSQRLARQRQIDPEQIADLSIWLVV AAIPAARLYYVAFNWGFYQKHLDQVVQIWKGGIAIHGAILGGIVAMAIFTYVQRLSFWQV ADVVAPSLILGQAIGRWGNFFNSEAFGAPTDLPWKLYIPVPQRPPELINTAYYHPTFLYE SLWNVGVFLLLLWLFRQPRYQKPGTLLMVYAIAYSLGRFWIEGLRMDSLMLGPLRIAQVV SLVAIALGSWGLFRLYYQGKPLPDWQTP
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: tel:tll2157

STRING: 197221.tll2157

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of prolipoprotein diacylglyceryl transferase (lgt) in Thermosynechococcus elongatus?

Prolipoprotein diacylglyceryl transferase (lgt) in T. elongatus, like in other bacteria, catalyzes the first reaction in the three-step post-translational lipid modification pathway essential for bacterial lipoprotein biogenesis. This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine in the lipobox motif of prolipoproteins . This modification is critical for proper anchoring of lipoproteins to the membrane, which in turn affects diverse cellular functions including cell envelope maintenance, nutrient uptake, transport, and potentially adaptation to high-temperature environments characteristic of T. elongatus's natural habitat .

Methodology for studying lgt function involves complementation assays, where the native lgt gene is deleted and complemented with a variant from another species, as demonstrated with E. coli and Vibrio cholerae lgt genes . Researchers can assess protein function through growth assays at varying temperatures and expression of recombinant proteins to confirm pathway functionality.

How does the thermophilic nature of T. elongatus affect the structure and function of its lgt protein?

The lgt protein from T. elongatus would likely display thermostability adaptations consistent with proteins from thermophilic organisms. While the specific crystal structure of T. elongatus lgt is not directly reported in the search results, insights can be drawn from structural studies of related enzymes like E. coli lgt and other thermostable proteins from T. elongatus.

T. elongatus proteins typically demonstrate enhanced structural rigidity, increased hydrophobic interactions, additional salt bridges, and reduced flexible loops compared to mesophilic counterparts . These adaptations would likely apply to T. elongatus lgt, potentially resulting in a protein that maintains activity at temperatures up to 70°C—similar to other T. elongatus enzymes like sucrose phosphate synthase (SPS) .

The methodological approach to investigating these thermostability features would include:

  • Thermal shift assays to determine protein melting temperatures

  • Comparative activity assays across temperature gradients (30-70°C)

  • Circular dichroism spectroscopy to monitor secondary structure stability

  • Molecular dynamics simulations to identify stabilizing interactions

What expression systems are most suitable for recombinant production of T. elongatus lgt?

  • Codon optimization for E. coli expression while preserving key thermostable features

  • Temperature modulation during expression (typically lower than native T. elongatus conditions)

  • Use of specialized E. coli strains adapted for membrane protein expression

  • Incorporation of solubility-enhancing fusion tags (His, MBP, SUMO)

The experimental approach would involve testing multiple expression vectors and E. coli host strains. A comparative expression analysis could be set up as follows:

Expression SystemInduction MethodGrowth TemperatureYield (mg/L)Activity Retention
E. coli BL21(DE3)IPTG (0.5mM)30°CVariableBaseline
E. coli C41/C43IPTG (0.1mM)25°CHigherEnhanced
E. coli Lemo21IPTG + rhamnose25°CVariableVariable
E. coli SoluBL21IPTG (0.2mM)20°CModerateHighest

Successful expression would be validated by SDS-PAGE, Western blotting, and functional assays comparable to those used for E. coli lgt characterization .

How can T. elongatus lgt be genetically engineered for functional studies compared to mesophilic bacterial lgt counterparts?

Engineering T. elongatus lgt for comparative functional studies with mesophilic counterparts requires strategic approaches to isolate temperature effects from inherent enzymatic differences. Advanced methodologies include:

  • Chimeric protein construction: Creating fusion proteins containing domains from both T. elongatus lgt and mesophilic lgt proteins (e.g., from E. coli) to identify regions responsible for thermostability versus catalytic function .

  • Site-directed mutagenesis targeting specific residues: Based on crystal structure information from E. coli lgt (1.9Å resolution) , corresponding conserved residues in T. elongatus lgt can be modified. Key targets would include catalytic residues identified in E. coli lgt, such as Arg143 and Arg239, which are essential for diacylglyceryl transfer .

  • Complementation systems: Utilizing lgt-deleted strains similar to those described for E. coli (strain MMS1742) and V. cholerae (strain MMS1663) to test functionality of T. elongatus lgt and engineered variants.

  • Temperature-sensitive selection systems: Leveraging the thermophilic nature of T. elongatus to develop selection systems where growth at specific temperatures indicates functional complementation .

The experimental workflow would involve creating an lgt deletion in E. coli complemented by T. elongatus lgt on a temperature-controlled expression vector, followed by functional analysis at varying temperatures.

What are the structural determinants of substrate specificity in T. elongatus lgt compared to other bacterial enzymes?

Investigating substrate specificity of T. elongatus lgt would build upon structural insights from related enzymes. The crystal structures of E. coli lgt in complex with phosphatidylglycerol and palmitic acid (at 1.9 and 1.6 Å resolution, respectively) provide a foundation for comparative analysis.

Key methodological approaches include:

  • Homology modeling and molecular docking of T. elongatus lgt with various lipid substrates

  • Activity assays with different phospholipid substrates to determine specificity profiles

  • Binding studies using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

  • Co-crystallization attempts with substrate analogs to determine T. elongatus lgt-specific binding modes

Critical structural elements likely include the binding pocket architecture, which in E. coli lgt features two binding sites that accommodate the phospholipid substrate and the prolipoprotein acceptor . Temperature-dependent conformational changes may affect substrate access channels and binding site geometry in the thermophilic variant.

Expected substrate specificity differences might be visualized in a comparative table:

Substrate TypeE. coli lgt ActivityT. elongatus lgt ActivityStructural Basis
PhosphatidylglycerolHigh (baseline)Potentially modifiedAltered hydrophobic interactions
PhosphatidylethanolamineModeratePotentially enhancedModified head group recognition
Shorter acyl chainsLowPotentially higherAdapted binding pocket flexibility
Non-canonical lipidsVery lowPotentially selectiveThermostable binding site constraints

How does lateral gene transfer influence the evolution of lgt in Thermosynechococcus elongatus?

Lateral gene transfer (LGT) significantly impacts prokaryotic evolution, and T. elongatus lgt likely reflects this evolutionary process. Analysis of lgt genes across cyanobacterial lineages would reveal potential horizontal acquisition events or recombination within the gene .

Advanced methodological approaches include:

  • Phylogenomic analysis comparing lgt sequences across diverse bacterial phyla

  • Detection of "observable recombination breakpoints" (ORBs) within the lgt gene, which would indicate fragment-based lateral transfer rather than whole-gene transfer

  • Codon usage analysis to identify regions with atypical patterns

  • Synteny analysis of genomic regions surrounding lgt in T. elongatus compared to other cyanobacteria

Research by Chan et al. has shown that approximately 32.6% of single-copy, putatively orthologous genes demonstrate evidence of LGT, with 19.6% showing recombination breakpoints within the open reading frame . This methodology could be applied specifically to T. elongatus lgt to determine if it contains fragments acquired from different lineages.

A properly designed experimental approach would include:

  • Sequence collection from diverse bacterial sources

  • Multiple sequence alignment focusing on conserved motifs

  • Phylogenetic incongruence testing

  • Statistical analysis of potential recombination events using programs like RDP4 or GARD

What biocontainment strategies can be employed when working with recombinant T. elongatus lgt in experimental settings?

The thermophilic nature of T. elongatus provides natural biocontainment opportunities for recombinant work with its lgt gene. Experimental evidence shows that genetically engineered T. elongatus BP1 strains completely die after 2 weeks of exposure to cool temperatures (15.44°C-25.30°C), while wild-type cells require 2-4 weeks for complete death .

Advanced biocontainment methodologies include:

  • Temperature-sensitive genetic circuits: Engineering recombinant T. elongatus lgt expression systems that function only within specific temperature ranges (above 30°C)

  • Auxotrophic complementation systems: Creating dual-containment by combining temperature sensitivity with auxotrophy, where the recombinant strain requires specific nutrients absent in natural environments

  • Genetic kill-switches: Developing systems where exposure to low temperatures triggers self-destruction pathways

  • lgt-based containment: Using the essentiality of lgt for survival in a similar manner to the system developed for E. coli, where viability depends on the presence of a complementing lgt gene on a controlled vector

The effectiveness of these containment strategies could be experimentally validated through environmental simulation studies tracking survival rates under various conditions:

Temperature RangeWild-type SurvivalRecombinant Survival with lgt-based containmentTime to Complete Death
15.44°C-25.30°CLowNone2-4 weeks (WT), 2 weeks (GE)
31.42°C-36.27°CHindered growthMinimalCells remain viable but dormant
50°C-57°COptimal growthControlled growthN/A - active growth

What purification strategies are most effective for obtaining highly pure and active recombinant T. elongatus lgt protein?

Purifying recombinant T. elongatus lgt presents challenges due to its membrane-associated nature and thermostability requirements. Effective methodological approaches include:

  • Detergent screening: Systematic testing of detergents for solubilization while maintaining protein structure and function. A methodical approach would test mild (DDM, LMNG), moderate (OG, FC-12), and harsh (SDS, LDAO) detergents.

  • Heat purification step: Leveraging the thermostability of T. elongatus lgt by incorporating a heat treatment (60-70°C) to denature E. coli host proteins while leaving the thermostable lgt intact .

  • Chromatography sequence optimization:

    • Initial IMAC (immobilized metal affinity chromatography) using His-tagged constructs

    • Ion exchange chromatography to remove impurities

    • Size exclusion chromatography for final polishing

    • All buffers maintained at elevated temperatures (40-50°C) with appropriate detergent concentrations

  • Native purification approach: Similar to methods used for native cytochrome c6 from T. elongatus, where the protein was purified directly from the organism grown under optimal conditions .

A comparative analysis of purification yields could be represented as:

Purification StrategyStarting BiomassDetergentTemperatureYield (mg/L culture)Purity (%)Activity Retention (%)
Recombinant + IMAC5g E. coliDDM 0.05%25°C1-285-9060-70
Heat + IMAC5g E. coliDDM 0.05%60°C step0.5-195+80-90
Native from T. elongatus10g cellsMinimal50°C0.1-0.390-9590-100

How can crystal structures of T. elongatus lgt be obtained and what special considerations apply due to its thermophilic nature?

Obtaining crystal structures of T. elongatus lgt requires specialized approaches due to its membrane protein nature and thermophilic origin. Methodology should be informed by successful crystallization of other T. elongatus proteins and membrane proteins like E. coli lgt .

Key methodological considerations include:

  • Construct optimization: Creating truncated versions or stabilized variants through:

    • N- and C-terminal truncations

    • Surface entropy reduction

    • Introduction of thermostabilizing mutations

    • Fusion to crystallization chaperones (e.g., T4 lysozyme)

  • Lipid cubic phase (LCP) crystallization: Particularly effective for membrane proteins, providing a native-like environment for lgt.

  • Temperature considerations: Crystallization trials should explore both the physiological temperature range of T. elongatus (45-60°C) and conventional temperatures (4-25°C).

  • Co-crystallization strategies: Including substrate analogs, inhibitors (like palmitic acid used with E. coli lgt), or binding partners to stabilize specific conformations .

  • Data collection adaptations: Thermophilic proteins often diffract to higher resolution due to their inherent rigidity, but may require special handling during cryoprotection.

The crystallization workflow would involve screening hundreds of conditions across multiple protein constructs, similar to the approach used for cytochrome c6 from T. elongatus, which yielded crystals in two different space groups (H3 and C2) diffracting to 1.7 and 2.25 Å resolution, respectively .

What in vitro assay systems can be developed to accurately measure the enzymatic activity of recombinant T. elongatus lgt?

Developing robust assay systems for T. elongatus lgt activity requires adaptations of existing methodologies used for mesophilic lgt enzymes, with special considerations for temperature optima and substrate accessibility.

Advanced methodological approaches include:

  • GFP-based in vitro assay: Similar to the approach mentioned for E. coli lgt, fluorescent reporter systems can be adapted to higher temperatures to correlate lgt activity with structural observations .

  • Radiolabeled substrate incorporation: Using tritium-labeled phospholipids to track transfer of the diacylglyceryl moiety to acceptor peptides containing the lipobox motif.

  • Mass spectrometry-based assays: Developing a liquid chromatography-mass spectrometry (LC-MS) workflow to detect modified peptides, allowing precise quantification of substrate conversion.

  • High-temperature adaptation considerations:

    • Buffer systems stable at elevated temperatures (HEPES or phosphate rather than Tris)

    • Temperature gradients to determine optimal activity (likely around 70°C based on other T. elongatus enzymes)

    • Substrate stability verification at high temperatures

A comprehensive activity profiling experiment would measure enzyme kinetics across multiple temperatures:

Temperature (°C)Relative Activity (%)Km (μM)kcat (s⁻¹)Stability (t1/2)
3020-30HigherLowerVery long
4550-60ModerateModerateLong
5780-90OptimalHighModerate
7090-100OptimalHighestShorter
8050-70VariableVariableVery short

How can site-directed mutagenesis be used to identify critical residues in T. elongatus lgt and correlate them with structural features?

Site-directed mutagenesis studies of T. elongatus lgt would build upon findings from E. coli lgt, where residues like Arg143 and Arg239 were identified as essential for diacylglyceryl transfer . Comprehensive methodology would include:

  • Homology modeling to identify corresponding residues in T. elongatus lgt based on E. coli lgt structure

  • Systematic mutation approach targeting:

    • Putative catalytic residues (corresponding to E. coli His158 and Glu331)

    • Substrate binding pocket residues

    • Thermostability-conferring residues unique to T. elongatus

    • Membrane interface residues

  • Functional complementation testing similar to the lgt-knockout system described for E. coli, where different mutant lgt variants were tested for their ability to complement an lgt deletion

  • Correlation of mutational effects with structural features through:

    • Activity assays at multiple temperatures

    • Thermal stability measurements

    • Substrate binding analyses

Based on structural studies of other enzymes like SPS from T. elongatus, special attention should be paid to flexible loops that may be crucial for substrate binding and product release, as well as residues involved in hydrogen bonding networks .

Expected results could be presented in a structure-function correlation table:

ResidueCorresponding E. coli ResidueMutationEffect on ActivityEffect on ThermostabilityStructural Role
His(X)His158His→AlaComplete lossMinimal changeCatalytic
Glu(Y)Glu331Glu→AlaComplete lossMinimal changeCatalytic
Arg(Z)Arg143Arg→LysPartial retentionMinimal changeSubstrate binding
Unique thermostable residuesN/AVariousVariableSignificant decreaseThermostability

How might T. elongatus lgt be engineered for broader substrate specificity or enhanced catalytic efficiency at lower temperatures?

Engineering T. elongatus lgt for modified temperature dependence or substrate specificity represents an advanced research direction with both fundamental and potential applied significance. Methodological approaches would include:

  • Rational design based on comparative analysis with mesophilic lgt enzymes:

    • Identification of rigid regions unique to T. elongatus lgt

    • Strategic introduction of glycine residues to increase flexibility

    • Modification of surface charge distribution to alter temperature-dependent properties

  • Directed evolution strategies:

    • Development of selection systems based on lgt complementation at reduced temperatures

    • Error-prone PCR to generate variant libraries

    • Screening for variants with enhanced activity at 30-40°C

  • Domain swapping between T. elongatus lgt and mesophilic counterparts:

    • Creation of chimeric enzymes with hybrid properties

    • Systematic replacement of loops and structural elements

    • Testing function through complementation assays

  • Molecular dynamics simulation to predict modifications:

    • Identification of regions with temperature-dependent dynamics

    • Prediction of stabilizing interactions at lower temperatures

    • Virtual screening of substrate variants against modeled binding sites

Expected outcomes would include the development of variant enzymes with shifted temperature profiles, potentially useful for biotechnological applications where thermostability is desirable but extreme temperatures are impractical.

What insights can comparative genomics provide about the evolution of lgt across thermophilic and mesophilic cyanobacteria?

Comparative genomics approaches offer powerful tools for understanding the evolutionary trajectory of lgt in thermophilic organisms like T. elongatus compared to mesophilic counterparts. Methodological strategies include:

  • Comprehensive phylogenetic analysis:

    • Sequence collection from diverse cyanobacterial lineages

    • Construction of gene trees versus species trees to identify incongruencies

    • Analysis of selection pressures using dN/dS ratios across lineages

  • Identification of lateral gene transfer and recombination events:

    • Detection of observable recombination breakpoints (ORBs) within lgt sequences

    • Analysis of genomic context and synteny across species

    • Comparison of GC content and codon usage patterns

  • Structural comparison across temperature adaptations:

    • Mapping of conserved versus variable regions onto protein structures

    • Identification of thermostability-associated amino acid substitutions

    • Correlation of structural features with optimal growth temperatures

  • Integration with experimental validation:

    • Expression of lgt variants from different temperature-adapted species

    • Functional complementation testing across temperature ranges

    • Structure determination of multiple homologs for direct comparison

This research would contribute to fundamental understanding of how essential genes adapt to extreme environments while maintaining critical functions, potentially revealing generalizable principles of protein thermoadaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.