Recombinant Thermosynechococcus elongatus UPF0754 membrane protein tlr2287 (tlr2287)

Shipped with Ice Packs
In Stock
Cat. No.
BT2491550
Source
in vitro E.coli expression system
Synonyms
tlr2287; UPF0754 membrane protein tlr2287
Quick Inquiry

Description

Introduction to Recombinant Thermosynechococcus elongatus UPF0754 Membrane Protein tlr2287 (tlr2287)

The Recombinant Thermosynechococcus elongatus UPF0754 membrane protein tlr2287, also known as tlr2287, is a recombinant protein derived from the thermophilic cyanobacterium Thermosynechococcus elongatus. This protein is expressed in Escherichia coli (E. coli) and is tagged with a His-tag at the N-terminal for easy purification and identification. The tlr2287 protein is of particular interest in scientific research due to its unique characteristics and potential applications in biotechnology.

Characteristics of Recombinant tlr2287 Protein

  • Species: The protein is derived from Thermosynechococcus elongatus, a thermophilic cyanobacterium known for its ability to thrive in high-temperature environments .

  • Expression System: It is expressed in E. coli, a common host for recombinant protein production due to its well-understood genetics and ease of cultivation .

  • Tag: The protein is N-terminally His-tagged, facilitating purification using nickel affinity chromatography .

  • Length and Sequence: The full-length protein consists of 414 amino acids. The amino acid sequence is detailed and includes various motifs that may be involved in its function .

References Locations of membrane protein production in a cyanobacterium Recombinant Full Length Thermosynechococcus Elongatus UPF0754 Membrane Protein Tlr2287 Complete Genome Structure of the Thermophilic Cyanobacterium Thermosynechococcus elongatus BP-1

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tlr2287; UPF0754 membrane protein tlr2287
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Thermosynechococcus elongatus (strain BP-1)
Target Names
tlr2287
Target Protein Sequence
MADISYWTLLVPPLAGGVIGYFTNDLAITMLFRPYKPIYIGGKQVPFTPGLIPRNQERLA RRIADAILGSLLTPEELQNLARRLLQVQRVKAVIHWLLQTSLSQIQAQSEQRSAQVLANI LRDFFGSALPRLMKVWSRREDFLEPQLNQLFDQVLVELQLSDEQAEKLADWLLSVMLPPD RLRLAIIDFLTDRTINVLDQELRQNTSGTYWVVANLVGVRNTLIRLREYCLNEREACNRR LGDLITALALRQRLVEALQNLTLQSLPLGTVRELRQLFRQTVRSYIQEQGASVIETVSQT VEWETISLSILRRLRDSASLGASLEVVSDELALVLDRYLERDMELIVERAIPILDLDRVI VDRVKATSPENLELAIQGIVRSELQAIVRLGGILGFLIGVVQAGVLYWQSLQVP
Uniprot No.
Q8DGM9

Target Background

Database Links

KEGG: tel:tlr2287

STRING: 197221.tlr2287

Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.