Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 2 (ctaC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ctaC; Cytochrome c oxidase subunit 2; Cytochrome aa3 subunit 2; Cytochrome c oxidase polypeptide II; Oxidase aa(3 subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-327
Protein Length
Full Length of Mature Protein
Species
Thermosynechococcus vulcanus (Synechococcus vulcanus)
Target Names
ctaC
Target Protein Sequence
VGHHHGLLPEQASEQAPLVDNFFDIMLTIGTALFLVVQGAIILFVIRYRRRAGEEGDGLP VEGNLPLEAFWTAIPALIVIFLGIYSVDIFQRMGGLNPGDHAMHSMHAPKSGMAVVAQAP SKTTSDATALLAAAQPPEIGIGASPDVQGKAPDLVVDVAGMQYAWIFTYPDSGIVSGELH IPVGKDVQLNLSARDVIHSFWVPQFRLKQDAIPGVPTTRFKATKVGTYPVVCAELCGGYH GAMRTQVIVHTPEDFETWRRQNQAIATAPVIPSLRDRHIHEMGVTAELVAQVEAIAHDPS AEKL
Uniprot No.

Target Background

Function
Subunits I and II constitute the enzyme complex's functional core. Electrons from cytochrome c are transferred via heme a and Cu(A) to the binuclear center comprising heme a3 and Cu(B).
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant Thermosynechococcus vulcanus ctaC protein?

For optimal stability and activity of recombinant Thermosynechococcus vulcanus ctaC protein, the following storage conditions are recommended:

  • Long-term storage: -20°C to -80°C in aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Post-reconstitution: Addition of 5-50% glycerol (final concentration) for long-term storage

Research indicates that repeated freeze-thaw cycles significantly reduce protein activity, so dividing the purified protein into single-use aliquots is strongly recommended .

What expression systems are typically used for producing recombinant Thermosynechococcus vulcanus ctaC?

Recombinant Thermosynechococcus vulcanus ctaC is typically expressed in E. coli expression systems. The full-length mature protein (amino acids 24-327) is often fused to an N-terminal His-tag to facilitate purification using affinity chromatography.

The expression procedure generally involves:

  • Cloning the gene into an appropriate expression vector

  • Transformation into a compatible E. coli strain

  • Expression induction (typically IPTG-based for T7-driven systems)

  • Cell lysis and purification via His-tag affinity chromatography

  • Quality control via SDS-PAGE (>90% purity is standard)

While E. coli is the most common heterologous host, some researchers have explored alternative expression systems for thermophilic proteins, including expression in other cyanobacterial systems .

How does the genetic context of ctaC differ among Thermosynechococcus strains, and what implications does this have for functional studies?

The genomic organization of cytochrome c oxidase operons shows significant variation among cyanobacterial species. In Thermosynechococcus vulcanus, ctaC is part of an operon encoding the core subunits of cytochrome c oxidase. Comparative genomic analyses of different Thermosynechococcus strains reveal both conservation and divergence in this region.

Key findings from genomic comparisons include:

This genetic context is crucial to consider when studying recombinant ctaC, as expression patterns and post-translational modifications may vary depending on strain-specific regulatory elements. For functional studies, it's important to determine whether the recombinant protein represents the constitutive or specialized forms of the enzyme .

What methodological approaches are recommended for analyzing the thermostability of recombinant Thermosynechococcus vulcanus ctaC?

Analyzing the thermostability of recombinant Thermosynechococcus vulcanus ctaC requires specialized techniques to account for its thermophilic origin. Recommended methodological approaches include:

  • Differential Scanning Calorimetry (DSC)

    • Measures heat capacity changes during thermal denaturation

    • Provides melting temperature (Tm) values

    • Typically shows higher Tm values for T. vulcanus proteins compared to mesophilic homologs

  • Circular Dichroism (CD) Spectroscopy with Temperature Ramping

    • Monitors secondary structure changes at increasing temperatures

    • Can be used to generate thermal denaturation curves

    • Recommended wavelengths: 222 nm for α-helical content monitoring

  • Activity Assays at Various Temperatures

    • Oxygen consumption measurements using Clark-type electrodes

    • Optimal temperature range for testing: 45-65°C

    • Control experiments should include mesophilic cytochrome c oxidases

  • Thermal Inactivation Time-Course Analysis

    • Pre-incubation at different temperatures followed by activity measurements

    • Plot of log(residual activity) vs. time provides inactivation rate constants

    • Half-life at elevated temperatures can be calculated from these data

These methodologies should be adapted to the specific experimental questions, with appropriate controls for buffer stability at high temperatures .

How does the structure-function relationship of Thermosynechococcus vulcanus ctaC relate to its adaptation to high-temperature environments?

The structure-function relationship of Thermosynechococcus vulcanus ctaC reflects several adaptations to high-temperature environments:

These adaptations allow the protein to maintain structural integrity and function at the optimal growth temperature of T. vulcanus (45-63°C) .

What experimental design considerations are important when studying the effects of temperature on recombinant Thermosynechococcus vulcanus ctaC activity?

When studying temperature effects on recombinant Thermosynechococcus vulcanus ctaC activity, researchers should carefully consider the following experimental design factors:

Temperature Range and Equilibration

  • Test activity across a broad temperature range (25-75°C)

  • Allow adequate equilibration time at each temperature (minimum 10-15 minutes)

  • Use precise temperature control systems with ±0.5°C accuracy

  • Measure actual sample temperature rather than relying on instrument settings

Buffer Considerations

  • Select buffers with minimal temperature-dependent pH shifts

  • HEPES or phosphate buffers are generally suitable

  • Pre-equilibrate all reagents to target temperatures

  • Control for buffer evaporation at higher temperatures

Experimental Replication Structure

Condition TypeRecommended ReplicatesAnalytical Approach
BiologicalMinimum 3 independent protein preparationsMixed-effects models
Technical3-5 per biological replicateNested ANOVA
Temperature pointsMinimum 6-8 across rangeNon-linear regression

Controls and Normalization

  • Include protein stability controls at each temperature

  • Measure background rates without substrate

  • Consider time-course measurements to capture potential thermal inactivation

  • Normalize activity to active protein concentration rather than total protein

Meta-analysis of Temperature Effects

Following data collection, implement statistical approaches as described by Shadish et al. :

  • Use interrupted time-series analysis for temperature transition effects

  • Apply meta-analytic methods to detect patterns across experimental conditions

  • Test for misspecification with weighted error sum of squares

  • Employ Q-tests assuming normality when using large numbers of replicates

How do photoreceptors and signaling pathways in Thermosynechococcus vulcanus interact with respiratory components like ctaC?

Thermosynechococcus vulcanus employs sophisticated signaling networks that coordinate photoreception with respiratory processes, potentially involving cytochrome c oxidase components like ctaC. This coordination is particularly evident in phototaxis and cellular aggregation responses.

Research has revealed several key interactions:

  • Photoreceptor-Mediated Signaling:

    • T. vulcanus contains multiple photoreceptors including cyanobacteriochromes SesA, SesB, and SesC

    • SesA functions as a blue light-activated diguanylate cyclase that synthesizes c-di-GMP

    • Green light promotes positive phototaxis, while blue light induces negative phototaxis

    • The switching between these responses occurs rapidly (within 1 minute) and involves c-di-GMP signaling

  • Respiratory Control and Light Quality:

    • Different wavelengths of light (blue, teal, green, red) trigger distinct physiological responses

    • Under blue light, wild-type cells show a three-fold higher c-di-GMP content compared to other light conditions

    • The ΔsesA mutant loses this blue light-dependent increase in c-di-GMP levels

    • These signaling changes may influence respiratory activity and potentially ctaC function

  • Cellular Movement and Aggregation:

    • T. vulcanus exhibits rapid movement (20-50 μm min-1) on solid surfaces

    • This movement is 5-10 times faster than related cyanobacteria like Synechocystis

    • The direction of movement is controlled by light quality and potentially involves adjustments in respiratory activity

    • Blue light induces microcolony formation, which may require altered respiratory function

While direct experimental evidence linking ctaC specifically to these photoreceptor pathways is limited, the coordination between photosynthesis, respiration, and cellular behavior suggests potential regulatory connections that warrant further investigation .

What approaches should be used to study the role of recombinant Thermosynechococcus vulcanus ctaC in bioenergetic processes at high temperatures?

Studying the role of recombinant Thermosynechococcus vulcanus ctaC in high-temperature bioenergetic processes requires specialized approaches that account for both its thermophilic nature and membrane-associated functions:

Respiration Measurements at Elevated Temperatures

  • Use high-temperature-adapted Clark-type oxygen electrodes

  • Implement temperature-controlled reaction chambers (45-65°C)

  • Measure oxygen consumption rates with various electron donors

  • Compare activity with native membrane preparations and reconstituted systems

Membrane Potential and Proton Gradient Analysis

  • Employ fluorescent probes stable at high temperatures (e.g., modified DiSC3(5))

  • Measure ΔpH using pH-sensitive fluorophores with corrections for temperature effects

  • Quantify proton pumping efficiency at different temperatures

  • Calculate H+/e- ratios to assess bioenergetic efficiency

Proteoliposome Reconstitution for Functional Studies

  • Purify recombinant ctaC with appropriate detergents

  • Prepare liposomes with thermostable lipid compositions

  • Reconstitute protein into liposomes via detergent removal

  • Assess proton pumping and electron transfer activities

  • Measure membrane integrity at elevated temperatures

Comparative Analysis Workflow

  • Isolate native cytochrome c oxidase complexes from T. vulcanus membranes

  • Purify recombinant ctaC under native-like conditions

  • Compare structural integrity via CD spectroscopy and thermal stability

  • Assess functional parameters (Km, Vmax, H+/e- ratio) across temperature range

  • Evaluate inhibitor sensitivity profiles at different temperatures

These approaches allow researchers to determine how the structural adaptations of ctaC contribute to maintaining bioenergetic efficiency at the elevated temperatures where T. vulcanus naturally thrives .

How can gene disruption techniques be applied to study ctaC function in Thermosynechococcus vulcanus?

Gene disruption techniques provide powerful tools to investigate ctaC function in Thermosynechococcus vulcanus through loss-of-function studies. Based on successful approaches used for other genes in this organism, the following methodological framework is recommended:

Transformation and Homologous Recombination Strategy

Thermosynechococcus strains can perform natural transformation of foreign DNA via homologous recombination. This property can be leveraged to create ctaC knockout mutants:

  • Construct a vector containing:

    • 2-3 kbp upstream homologous sequence

    • Antibiotic resistance cassette (chloramphenicol, kanamycin, or spectinomycin)

    • 2-3 kbp downstream homologous sequence

  • Use assembly cloning (AQUA cloning) for efficient vector construction

  • Transform T. vulcanus according to established protocols:

    • Culture at 45°C in BG-11 medium under white light (30 μmol photons m-2 s-1)

    • Dilute cultures to OD730 of ~0.3 before transformation

    • Add DNA construct to competent cells

    • Select transformants on media containing appropriate antibiotics

    • Chloramphenicol (5 μg ml-1), kanamycin (80 μg ml-1), or spectinomycin plus streptomycin (10 plus 5 μg ml-1)

Verification of Mutants

Complete segregation of mutant alleles in all copies of the chromosomal DNA must be verified:

  • Perform colony PCR with primers flanking the insertion site

  • Confirm correct mutations by Sanger sequencing of PCR fragments

  • Ensure absence of wild-type bands in PCR products

Complementation Studies

To confirm phenotypes are due to ctaC disruption:

  • Create complementation constructs with the wild-type ctaC gene

  • Use an inducible or constitutive promoter

  • Introduce at a neutral site in the genome or on a replicative plasmid

  • Verify restoration of wild-type phenotype

Phenotypic Analysis

Assess the impact of ctaC disruption on:

  • Growth rates at different temperatures (31°C vs. 45°C)

  • Oxygen consumption under different light conditions

  • Photosynthetic parameters

  • Cell aggregation and phototaxis behavior

  • Stress responses

Based on studies with related systems, it's likely that other terminal oxidases in T. vulcanus might compensate for ctaC disruption, potentially resulting in subtle phenotypic changes rather than lethal effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.