Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 3 (ctaE)

Shipped with Ice Packs
In Stock

Description

Key Features:

FeatureDescriptionSource
Operon StructureGenes ordered as ctaCDE(F); ctaE corresponds to subunit III (COIII) .
Sequence HomologyClosely resembles Bacillus subtilis COIII; lacks mitochondrial and Paracoccus-specific regions .
Conserved MotifsContains hydrophobic segments critical for membrane integration and enzyme stability .
Protein Length201 amino acids (full-length recombinant version) .

The absence of mitochondrial-specific regions (e.g., hydrophobic segments I and II in COIII) and the presence of Bacillus-like features highlight its evolutionary divergence from eukaryotic COX .

Recombinant Production and Biochemical Properties

Recombinant ctaE is produced for structural and functional studies. Below are key production parameters and properties:

Production and Purification

ParameterValueSource
Expression HostE. coli (commonly used) ; yeast (alternative systems) .
TagHis-tag (N-terminal) ; other tags may vary by manufacturer .
Purity>85% (SDS-PAGE verified) .
Storage BufferTris-based buffer with 50% glycerol, optimized for stability at -20°C .

Role in Cytochrome c Oxidase

COIII (ctaE) is a membrane-bound subunit critical for stabilizing the enzyme’s structure and facilitating proton translocation. Studies on Thermosynechococcus vulcanus COX reveal:

  • Thermal Stability: Adaptations in hydrophobic segments enable function at high temperatures (e.g., 63°C) .

  • Electron Transport Efficiency: Interactions between COIII and other subunits (e.g., COI, COII) are essential for catalytic activity .

Experimental Uses

ApplicationDescriptionSource
Structural StudiesX-ray crystallography to resolve membrane topology and subunit interactions .
Protein-Protein InteractionsCo-expression with ctaC (COII) and ctaD (COI) to study assembly mechanisms .
Thermostability AssaysTesting recombinant ctaE’s resistance to denaturation under extreme temperatures .

Comparative Analysis with Other Subunits

The ctaCDE(F) operon in Thermosynechococcus vulcanus differs from eukaryotic COX in subunit composition. Key distinctions include:

SubunitCyanobacterial COX (T. vulcanus)Mitochondrial COX
COIIIctaE (membrane-bound, conserved motifs) Includes mitochondrial-specific regions
COIVAbsent in cyanobacteria; ctaF may encode a homolog Present (encoded by COX4, etc.)

Challenges and Future Directions

  • Production Limitations: Recombinant ctaE often requires co-expression with other subunits for proper folding .

  • Functional Studies: Limited data on ctaE’s role in proton pumping or oxygen reduction compared to COI/COII .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctaE; Cytochrome c oxidase subunit 3; Cytochrome aa3 subunit 3; Cytochrome c oxidase polypeptide III; Oxidase aa(3 subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Thermosynechococcus vulcanus (Synechococcus vulcanus)
Target Names
ctaE
Target Protein Sequence
MQGTVESQGTAIAVDHAHEHPDFRVLGLLVFLISESLMFGGLFAAYLLLRGMHEQWPPEG TEVELFVPTINTLILISSSFVIHYGDVAIKKDDVRGMRKWYWITAAMGAVFLGGQVYEYL TLGYGLRTNVFANCFYVMTGFHGLHVFIGILLILGVIWRSRRPGHYNAQKHTGVAMAEIY WHFVDVIWIILFTLLYILTRF
Uniprot No.

Target Background

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermosynechococcus vulcanus and why is its cytochrome c oxidase of interest?

Thermosynechococcus vulcanus is a rod-shaped thermophilic cyanobacterium that has gained research interest due to its unique photosynthetic and respiratory components adapted to high-temperature environments . The cytochrome c oxidase of T. vulcanus is particularly valuable for study because it represents a prokaryotic variant of this essential respiratory enzyme that functions at elevated temperatures. Structural analysis reveals that T. vulcanus cytochrome oxidase shares greater homology with Bacillus cytochrome oxidases than with mitochondrial or Paracoccus enzymes, making it an important model for understanding the evolutionary relationships among terminal oxidases . Additionally, the thermostable nature of this enzyme makes it suitable for structural studies that are challenging with mesophilic counterparts.

How does subunit III (ctaE) contribute to cytochrome c oxidase function?

Subunit III (ctaE) plays crucial structural and functional roles in the cytochrome c oxidase complex. While not directly involved in electron transfer or oxygen reduction, subunit III is essential for maintaining the structural integrity of the enzyme complex and protecting the catalytic core from suicide inactivation during turnover. In T. vulcanus, ctaE exhibits structural differences from its counterparts in other organisms, notably lacking the first two hydrophobic segments found in some bacterial homologs . Despite these differences, the protein sequence analysis indicates that the conserved functional residues are present in all important regions, suggesting that these genes are operationally active in T. vulcanus . This structural modification may represent an adaptation to the high-temperature environment in which this thermophilic cyanobacterium thrives.

What are the optimal methods for recombinant expression of T. vulcanus ctaE?

For recombinant expression of T. vulcanus cytochrome c oxidase subunit III (ctaE), researchers should consider both heterologous and homologous expression systems. For heterologous expression, E. coli-based systems optimized for membrane proteins can be employed, though special considerations for this thermophilic protein are necessary. The expression vector should contain a strong inducible promoter (such as T7), a suitable affinity tag (preferably C-terminal His6), and codon optimization for E. coli. Cultivation should be performed at 30-37°C with induction at OD600 of 0.6-0.8 using 0.1-0.5 mM IPTG, followed by additional growth for 4-6 hours.

For homologous expression, the native T. vulcanus or the closely related T. elongatus system is preferable. This approach would follow protocols similar to those described for gene disruption experiments, where PCR-amplified genomic regions containing the target gene are cloned into appropriate vectors . When transforming T. vulcanus, methods described in the literature involving antibiotic selection (typically with chloramphenicol at 3.4 μg/ml) should be employed to maintain the expression constructs . This homologous approach might yield more properly folded and assembled protein due to the native cellular environment.

How can researchers optimize protein purification protocols for recombinant ctaE?

Purification of recombinant ctaE requires specialized approaches due to its membrane protein nature. Begin with cell lysis using either sonication or a French press in a buffer containing 50 mM phosphate (pH 7.5), 300 mM NaCl, 10% glycerol, and protease inhibitors. Membrane fraction isolation requires ultracentrifugation at 100,000 × g for 1 hour. For membrane protein extraction, use a gentle detergent such as n-Dodecyl β-D-maltoside (DDM) at 1% concentration for 1-2 hours at 4°C.

For affinity chromatography of His-tagged ctaE, use Ni-NTA resin with buffers containing 0.05% DDM to maintain protein solubility. After binding, wash extensively with increasing imidazole concentrations (10-40 mM) before elution with 250-300 mM imidazole. Size exclusion chromatography using a Superdex 200 column equilibrated with 25 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 0.03% DDM provides the final purification step. Throughout the process, maintain a temperature of 4°C and verify protein purity using SDS-PAGE with Coomassie staining. Western blotting with anti-His antibodies can confirm the identity of the purified protein.

What spectroscopic techniques are most informative for characterizing ctaE?

For comprehensive characterization of recombinant ctaE, multiple spectroscopic approaches should be employed. UV-visible absorption spectroscopy (250-700 nm) can verify the proper incorporation of heme cofactors in the holocomplex containing ctaE. Circular dichroism (CD) spectroscopy in the far-UV range (190-250 nm) is essential for secondary structure assessment, particularly alpha-helical content, which should be substantial in this membrane protein.

Fourier-transform infrared (FTIR) spectroscopy provides detailed insights into the secondary structure and can detect subtle conformational changes under different conditions. For higher resolution structural information, nuclear magnetic resonance (NMR) spectroscopy of isotopically labeled protein (15N, 13C) can be employed, though this is challenging for membrane proteins. Thermal stability can be assessed using differential scanning calorimetry (DSC) or CD spectroscopy with temperature ramping (20-90°C), which is particularly relevant for this thermophilic protein. When comparing wild-type and mutant forms, these techniques can reveal structural perturbations that may affect function, assembly, or stability.

How can researchers investigate the functional coupling between ctaE and other subunits?

Oxygen consumption measurements using Clark-type electrodes can quantify enzymatic activity at physiological temperatures (45-65°C for this thermophile). Steady-state kinetics with varying cytochrome c concentrations can reveal changes in KM and Vmax parameters that indicate altered subunit coupling. Proton pumping efficiency, assessed using reconstituted proteoliposomes with pH-sensitive dyes, offers insights into energy transduction efficiency. Time-resolved spectroscopy can detect changes in electron transfer rates between metal centers, while hydrogen/deuterium exchange mass spectrometry (HDX-MS) can map dynamic interactions between subunits under different conditions.

A complementary approach utilizes in vivo complementation studies, where mutated genes are expressed in ctaE-deficient strains to assess rescue of respiratory phenotypes. Successful implementation of these methods can reveal how ctaE modulates the catalytic efficiency, proton pumping, and stability of the cytochrome c oxidase complex in this thermophilic organism.

What is known about the thermal stability mechanisms of T. vulcanus ctaE compared to mesophilic homologs?

A distinctive feature of T. vulcanus ctaE is the absence of the first two transmembrane segments found in some bacterial counterparts . This structural modification may represent an adaptation that enhances stability in thermophilic environments by reducing potential weak points in the protein structure. Additionally, the thermostability may be enhanced by specific lipid interactions, as the membrane composition of T. vulcanus is adapted to high temperatures with increased saturated fatty acid content.

To experimentally investigate these stability mechanisms, researchers should perform thermal denaturation studies using circular dichroism spectroscopy, differential scanning calorimetry, and intrinsic fluorescence measurements comparing wild-type T. vulcanus ctaE with chimeric constructs incorporating domains from mesophilic homologs. Molecular dynamics simulations at varying temperatures can further elucidate the atomic-level determinants of thermostability.

How does cytochrome c oxidase assembly differ in thermophilic cyanobacteria compared to model organisms?

Cytochrome c oxidase assembly in thermophilic cyanobacteria like T. vulcanus likely involves distinct mechanisms compared to well-studied model organisms such as yeast or mammals. One notable difference is the absence of the ctaB gene in the proximity of the oxidase operon, unlike in Bacillus subtilis where it is co-transcribed with subunit II . This suggests alternative regulatory mechanisms for heme a biosynthesis or incorporation.

Blue native gel electrophoresis can resolve assembly intermediates, while complexome profiling (combining native electrophoresis with mass spectrometry) can identify associated assembly factors. Genetic approaches, including systematic deletion of putative assembly factor homologs identified through bioinformatic analysis, can reveal their functional importance. Since the oxidase genes are arranged in the order II-I-III-IV in T. vulcanus , cotranslational assembly may play a significant role, which can be investigated using ribosome profiling techniques coupled with structural studies of nascent assembly intermediates.

What are common challenges in expressing recombinant thermophilic membrane proteins and how can they be addressed?

Expressing recombinant thermophilic membrane proteins like T. vulcanus ctaE presents several significant challenges. Firstly, protein misfolding and aggregation often occur when expressing thermophilic proteins at lower temperatures in mesophilic hosts. To address this, researchers should optimize growth temperatures (30-37°C) and consider heat shock steps (brief incubation at 42-45°C) after induction to promote proper folding. Secondly, the hydrophobic nature of membrane proteins can be toxic to expression hosts. This can be mitigated by using C41(DE3) or C43(DE3) E. coli strains specifically developed for membrane protein expression, or by employing tightly regulated expression systems to control protein production rates.

The third challenge involves inefficient membrane insertion in heterologous systems. Researchers can overcome this by co-expressing molecular chaperones (GroEL/GroES) or using specialized membrane protein expression strains with enhanced membrane insertion capabilities. Finally, protein instability during purification can be addressed by screening multiple detergents beyond the commonly used DDM, such as LMNG, UDM, or digitonin, which may better preserve the native structure of thermophilic membrane proteins.

For specifically difficult constructs, alternative expression systems should be considered, including the homologous host T. elongatus, which provides the native cellular machinery for proper folding and assembly. Cell-free expression systems supplemented with nanodiscs or liposomes offer another viable approach for producing functional membrane proteins without cellular toxicity concerns.

How can researchers troubleshoot activity assays for recombinant cytochrome c oxidase?

When troubleshooting activity assays for recombinant T. vulcanus cytochrome c oxidase, researchers must address several common issues. First, insufficient enzymatic activity may result from improper cofactor incorporation. This can be resolved by supplementing growth media with δ-aminolevulinic acid (0.5 mM) and iron sources (100 μM FeSO4) to enhance heme biosynthesis. For copper incorporation, add 1-2 μM CuSO4 to expression cultures. Additionally, ensure proper post-translational modifications by considering homologous expression systems.

Second, temperature-dependent activity variations are particularly relevant for this thermophilic enzyme. Conduct assays at temperatures ranging from 25°C to 65°C to identify the optimal temperature, which is likely to be substantially higher than standard assay conditions used for mesophilic oxidases. Control buffer pH carefully, as it changes with temperature (approximately -0.017 pH units/°C for Tris buffers).

Third, detergent inhibition can significantly impact activity measurements. Screen multiple detergents at concentrations just above their critical micelle concentration, or consider reconstituting the enzyme into proteoliposomes composed of E. coli polar lipids supplemented with 10-20% thermophilic lipid extracts. Finally, cytochrome c compatibility issues may arise, as the enzyme may have evolved to interact with T. vulcanus cytochrome c. Test cytochrome c from multiple sources (equine, bovine, yeast, and if possible, native T. vulcanus) to identify the optimal electron donor for activity assays.

What approaches can be used to study the interaction between ctaE and c-di-GMP signaling systems?

To investigate potential interactions between cytochrome c oxidase subunit III (ctaE) and cyclic dimeric GMP (c-di-GMP) signaling systems in T. vulcanus, researchers should implement a comprehensive experimental strategy. Begin with bioinformatic analysis to identify potential c-di-GMP binding motifs in ctaE, focusing on known binding signatures like the PilZ domain or I-site motifs. Follow with direct binding assays using purified recombinant ctaE and radiolabeled or fluorescently tagged c-di-GMP to determine binding constants and specificity.

To explore functional connections, construct T. vulcanus strains with mutations in both cytochrome oxidase genes and key c-di-GMP metabolizing enzymes such as SesA, which is known to function as a blue light-activated diguanylate cyclase . Monitor phenotypes related to both respiration (oxygen consumption) and c-di-GMP-mediated behaviors (cell aggregation, biofilm formation) under varying light conditions. The relationship between respiratory activity and sessility can be investigated by manipulating cellular c-di-GMP levels while monitoring cytochrome oxidase activity.

Co-immunoprecipitation experiments with tagged ctaE can identify potential protein-protein interactions with components of the c-di-GMP signaling pathway. Microscopy techniques, including FRET between fluorescently labeled ctaE and c-di-GMP sensors, can visualize potential interactions in vivo. Additionally, compare intracellular c-di-GMP levels in wild-type and cytochrome oxidase mutant strains using LC-MS/MS to determine if respiratory activity influences second messenger signaling. This approach revealed that blue light exposure increases c-di-GMP levels approximately three-fold in wild-type T. vulcanus compared to other light conditions , providing a baseline for comparison with ctaE mutants.

How does T. vulcanus cytochrome c oxidase compare to other cyanobacterial and bacterial oxidases?

T. vulcanus cytochrome c oxidase exhibits several distinctive features compared to oxidases from other bacteria and cyanobacteria. Sequence analysis reveals that T. vulcanus cytochrome oxidase is phylogenetically closer to Bacillus cytochrome oxidases than to mitochondrial, Paracoccus, or quinol oxidases from B. subtilis and E. coli . Like Bacillus enzymes, the T. vulcanus oxidase genes are arranged in the order of subunits II, I, III, and IV, followed by a terminator structure . This organization differs from that found in proteobacteria and eukaryotes.

Structurally, T. vulcanus oxidase lacks certain elements found in other oxidases. It does not have a cytochrome c moiety fused to subunit II, which is present in some bacterial oxidases . The enzyme also lacks the 13th and 14th hydrophobic segments of subunit I (which are also absent in Paracoccus enzymes) and the 1st and 2nd transmembrane segments of subunit III that are found in some other oxidases but absent in Bacillus enzymes . These structural differences likely reflect adaptations to the thermophilic lifestyle and possibly to the unique bioenergetic needs of photosynthetic cyanobacteria.

Unlike some other bacteria, T. vulcanus lacks a ctaB gene in the proximity of the oxidase operon, suggesting differences in heme a biosynthesis regulation . These comparative differences make T. vulcanus cytochrome oxidase a valuable model for understanding the diversity and evolution of respiratory complexes across bacterial lineages.

What insights can ctaE studies provide for understanding respiratory adaptation to extreme environments?

Studies of T. vulcanus cytochrome c oxidase subunit III (ctaE) offer valuable insights into respiratory adaptations to extreme thermal environments. The thermostability of this protein likely involves specific structural modifications, including the absence of certain transmembrane segments found in mesophilic homologs . Analysis of these adaptations can reveal general principles of protein thermostabilization that extend beyond respiratory complexes to other membrane proteins.

The functional coupling between respiration and light-sensing in thermophilic cyanobacteria represents an intriguing adaptation. T. vulcanus integrates environmental light signals through photoreceptors like SesA, which produces c-di-GMP in response to blue light and influences cellular aggregation . This connection between light sensing, second messenger signaling, and potentially respiratory activity illustrates how extremophiles have evolved sophisticated regulatory networks to optimize energy metabolism under variable environmental conditions.

Comparative genomic and proteomic analyses between T. vulcanus and mesophilic cyanobacteria can identify conserved and divergent features of respiratory complexes. These insights contribute to our understanding of how core bioenergetic processes are maintained while adapting to extreme conditions. Furthermore, the thermostable nature of T. vulcanus respiratory complexes makes them excellent candidates for structural studies using techniques like cryo-electron microscopy, potentially revealing high-resolution details of cytochrome oxidase architecture that are difficult to obtain with less stable mesophilic counterparts.

How might recombinant ctaE be utilized in biotechnological applications?

The thermostable properties of recombinant T. vulcanus cytochrome c oxidase subunit III (ctaE) present several promising biotechnological applications. First, as part of the thermostable cytochrome oxidase complex, it could be utilized in biocatalytic oxygen sensing systems for industrial processes operating at elevated temperatures (45-65°C). Such sensors would offer superior stability compared to existing enzymes derived from mesophilic organisms, which typically denature above 40°C.

Second, the thermostable cytochrome oxidase complex containing ctaE could serve as a model system for developing membrane protein stabilization strategies applicable to other biotechnologically relevant proteins. The structural features that confer thermostability to T. vulcanus ctaE could be identified and incorporated into less stable proteins through protein engineering approaches.

Third, recombinant thermostable cytochrome oxidase has potential applications in biofuel cells and bioelectrochemical systems operating at higher temperatures. The enzyme's ability to catalyze the four-electron reduction of oxygen to water makes it valuable for cathodes in such devices, where elevated temperatures might be advantageous for increased reaction rates and reduced microbial contamination.

Finally, as an educational and research tool, purified recombinant ctaE and the complete oxidase complex offer excellent models for studying membrane protein structure, assembly, and function under varying conditions. Their inherent stability facilitates handling and storage, making them valuable reagents for biochemistry and biophysics laboratories. By elucidating the molecular determinants of thermostability in T. vulcanus cytochrome oxidase, researchers may gain insights applicable to protein engineering across various biotechnological fields.

What emerging technologies could advance our understanding of ctaE structure and function?

Emerging technologies hold significant promise for advancing our understanding of T. vulcanus ctaE structure and function. Cryo-electron microscopy (cryo-EM) with improved detectors and processing algorithms now allows near-atomic resolution of membrane protein complexes without crystallization. This approach could reveal the precise arrangement of ctaE within the oxidase complex and its interactions with other subunits. Complementary to cryo-EM, microcrystal electron diffraction (MicroED) offers another crystallography-free method for determining high-resolution structures of membrane proteins from nanoscale crystals.

Time-resolved spectroscopy techniques, including ultra-fast infrared and X-ray free-electron laser (XFEL) spectroscopy, can capture transient conformational states during the catalytic cycle, providing insights into how ctaE modulates the function of the catalytic core. For probing dynamics, advances in hydrogen/deuterium exchange mass spectrometry (HDX-MS) specifically optimized for membrane proteins can map flexible regions and conformational changes under different conditions.

Genetic technologies like CRISPR-Cas9 genome editing adapted for cyanobacteria enable precise manipulation of the endogenous ctaE gene, facilitating in vivo structure-function studies. Single-molecule techniques, including fluorescence resonance energy transfer (FRET) and atomic force microscopy (AFM), can monitor conformational dynamics of individual enzyme complexes during turnover. Finally, integrative structural biology approaches combining multiple data sources (cryo-EM, cross-linking mass spectrometry, molecular dynamics simulations) will provide the most comprehensive view of ctaE structure and dynamics within the complete oxidase complex.

What are potential links between respiratory function and phototaxis in T. vulcanus?

The potential links between respiratory function and phototaxis in T. vulcanus represent an intriguing area for future research. Current evidence suggests that both processes may be connected through second messenger signaling, particularly via cyclic dimeric GMP (c-di-GMP). T. vulcanus exhibits both positive and negative phototaxis controlled by specific green-to-blue light ratios, with the switching mediated by photoreceptors and their activity in c-di-GMP synthesis or degradation . The photoreceptor SesA increases cellular c-di-GMP levels more than three-fold under blue light compared to other light conditions , potentially affecting multiple cellular processes.

While direct evidence connecting cytochrome oxidase activity to phototactic responses is currently lacking, several hypotheses warrant investigation. Respiratory activity may influence the cellular energy state, affecting the ATP availability needed for type IV pilus-dependent cell movement during phototaxis . Changes in the redox state of the cell due to respiratory activity might also influence the photosensory state of cyanobacteriochromes like SesA, potentially creating a feedback mechanism between respiration and phototaxis.

Future research should explore these connections through combined genetic approaches, creating mutants with altered cytochrome oxidase activity and examining their phototactic responses. Real-time measurements of respiratory activity, c-di-GMP levels, and cell movement under different light conditions would provide valuable insights into the temporal relationships between these processes. Understanding these connections would illuminate how T. vulcanus integrates energy metabolism with environmental sensing and behavioral responses.

How might studying thermophilic cytochrome oxidases contribute to our understanding of protein evolution?

Studying thermophilic cytochrome oxidases like that of T. vulcanus provides unique opportunities for understanding protein evolution across temperature adaptations and phylogenetic lineages. Comparative genomic and structural analyses of cytochrome oxidases from thermophilic, mesophilic, and psychrophilic organisms can reveal evolutionary trajectories of temperature adaptation. The specific simplifications observed in T. vulcanus ctaE structure, such as the absence of certain transmembrane segments , may represent either ancestral states or derived adaptations to thermophilic environments.

Phylogenetic analysis indicates that T. vulcanus cytochrome oxidase is more closely related to Bacillus oxidases than to mitochondrial or proteobacterial enzymes , suggesting specific evolutionary paths for respiratory complexes in different bacterial lineages. This evolutionary relationship can be explored through ancestral sequence reconstruction and resurrection of inferred ancestral proteins, potentially revealing the sequence and structural changes that accompanied adaptation to different thermal environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.