Recombinant Thermotoga maritima ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
atpF; TM_1614; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
atpF
Target Protein Sequence
MGFLEINWTSAAMLMLFVLMVYFLNKFLYTPFIEMAEKRRKKVEEDLKSAEQLKEEAEKM RSEAERFLSEARQRADEIVESARKEAEAIVEEAREKAKKEAQNIVESAKTQIEVEYKKAL EQVQERAAELSVILATKLLQKVFQDERARREYLVKILKEEIEKS
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Database Links

KEGG: tma:TM1614

STRING: 243274.TM1614

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does the structure of T. maritima ATP synthase subunit b compare to those from other organisms?

The T. maritima ATP synthase subunit b shares structural similarities with other bacterial ATP synthases but has adapted for functioning at extreme temperatures. While maintaining the core functional domains, the T. maritima protein contains specific amino acid compositions that contribute to its thermostability.

Unlike many other bacterial species that use proton (H+) gradients, the ATP synthase from T. maritima operates using a sodium (Na+) gradient, making it a Na+-coupled F1F0-ATP synthase . This represents an adaptation to the extreme environments T. maritima inhabits. The sodium dependence of T. maritima ATP synthase activity follows Michaelis-Menten kinetics with a Km of approximately 1.2 ± 0.2 mM Na+ and a vmax of 4.7 U/mg .

Comparative analysis shows that while the core structure remains conserved, thermophilic ATP synthases like that from T. maritima typically feature more hydrophobic interactions, additional salt bridges, and optimized surface charges that contribute to their stability at high temperatures.

What are the optimal expression systems for producing recombinant T. maritima ATP synthase subunit b?

Escherichia coli is the most commonly used and effective heterologous expression system for producing recombinant T. maritima ATP synthase subunit b. The recombinant protein can be successfully expressed with various tags, with His-tagging being particularly effective for subsequent purification steps .

For optimal expression, consider the following methodology:

  • Vector selection: Use expression vectors with strong, inducible promoters (e.g., T7) suitable for thermostable protein expression.

  • E. coli strain selection: BL21(DE3) or Rosetta(DE3) strains are preferred as they are designed to express proteins from thermophilic organisms.

  • Expression conditions:

    • Induction at OD600 of 0.6-0.8

    • IPTG concentration: 0.5-1.0 mM

    • Post-induction temperature: 30-37°C (lower temperatures may improve solubility)

    • Expression time: 4-6 hours or overnight at reduced temperatures

The resulting His-tagged recombinant protein typically shows a molecular weight of approximately 20 kDa on SDS-PAGE analysis .

What are the most effective purification strategies for obtaining high-purity T. maritima ATP synthase subunit b?

For high-purity isolation of recombinant T. maritima ATP synthase subunit b, a multi-step purification process is recommended:

  • Affinity chromatography: For His-tagged constructs, Ni-NTA affinity chromatography is the primary purification step. Use a buffer containing 20-50 mM Tris-HCl pH 8.0, 300-500 mM NaCl, with imidazole gradient elution (20-250 mM) .

  • Size exclusion chromatography: Further purify the protein using a Sephacryl S300 or similar column to separate monomeric from aggregated forms.

  • Ion exchange chromatography: If necessary, use Q-sepharose chromatography as an additional purification step.

Research has shown that purification of the native ATP synthase complex from T. maritima often results in co-purification with other respiratory enzyme complexes, specifically the Rnf complex . When isolating just the atpF subunit, modified protocols may be necessary.

The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein integrity .

How can researchers effectively characterize the structure-function relationship of T. maritima ATP synthase subunit b?

To effectively characterize the structure-function relationship of T. maritima ATP synthase subunit b, researchers should employ a combination of biochemical, biophysical, and computational approaches:

  • Circular dichroism (CD) spectroscopy: This technique is particularly valuable for monitoring secondary structure changes induced by temperature, pH, or addition of metal ions. Research has shown that T. maritima ATP synthase gains secondary structure upon addition of specific divalent metal ions, particularly Co(II) and Mg(II) .

  • Site-directed mutagenesis: Identify and modify key residues to determine their contribution to thermostability and function. Focus on:

    • Conserved charged residues in the membrane-spanning region

    • Residues involved in subunit-subunit interactions

    • Potential metal-binding sites

  • Reconstitution studies: Incorporate the purified protein into liposomes to study its function in a membrane environment. This approach has been successfully used to demonstrate Na+ transport properties of the T. maritima ATP synthase complex :

    Table 1: Na+ Transport Activity in Reconstituted Proteoliposomes

    ConditionRelative Na+ AccumulationActivity (U/mg)
    ATP addition~2.5-fold2.6
    With Na+ ionophore ETH2120Inhibited-
    With protonophore TCSStimulated-
  • Thermal stability assays: Measure the melting temperature (Tm) and stability profile using differential scanning calorimetry (DSC) or thermal shift assays. The T. maritima ATP synthase components are highly thermostable with a T50 of approximately 93°C .

  • Computational modeling: Use homology modeling and molecular dynamics simulations to predict structural features and the impact of mutations, especially focusing on thermostability determinants.

What experimental approaches can distinguish the Na+-coupled activity of T. maritima ATP synthase from H+-coupled homologs?

To experimentally distinguish the Na+-coupled activity of T. maritima ATP synthase from H+-coupled homologs, several specialized approaches can be employed:

  • Ion dependence assays: Compare ATP hydrolysis rates across varying concentrations of Na+ and H+. T. maritima ATP synthase shows strict Na+ dependence with a Km of approximately 1.2 ± 0.2 mM Na+ .

  • DCCD inhibition studies: N,N'-dicyclohexylcarbodiimide (DCCD) inhibits ATP synthase activity by binding to ion-translocating carboxyl groups. In Na+-dependent ATP synthases like that of T. maritima, this inhibition can be relieved by adding Na+, which competes for the same binding site .

    Table 2: Effect of DCCD and Na+ on ATP Synthase Activity

    ConditionRelative Activity (%)
    Control100
    + DCCDInhibited
    + DCCD + Na+Partially restored
  • Radioisotope transport assays: Use 22Na+ to directly measure ion transport. In proteoliposomes containing reconstituted T. maritima ATP synthase, addition of ATP results in approximately 2.5-fold accumulation of 22Na+ .

  • pH vs. pNa sensitivity profiles: Compare enzyme activity across various pH and Na+ concentration gradients. Na+-coupled enzymes show distinct optimum curves compared to H+-coupled homologs.

  • Site-directed mutagenesis of ion-binding residues: Modify predicted Na+-coordinating residues and assess the impact on activity and ion selectivity.

These methods collectively provide robust evidence for the Na+-coupling mechanism of T. maritima ATP synthase and allow for detailed comparison with H+-coupled homologs from other organisms.

How can T. maritima ATP synthase subunit b be used to study bioenergetic adaptations to extreme environments?

T. maritima ATP synthase subunit b provides an excellent model for studying bioenergetic adaptations to extreme environments, particularly high temperatures. Researchers can leverage this system through several experimental approaches:

  • Comparative functional studies: Compare the activity and stability of T. maritima ATP synthase with mesophilic homologs across temperature ranges (25-95°C). This reveals how structural adaptations translate to functional differences. Studies have shown that while the ATP synthase from E. coli becomes denatured at high temperatures, T. maritima ATP synthase maintains significant activity even at 80°C .

  • Hybrid complex assembly: Create chimeric ATP synthases by replacing subunits from mesophilic organisms with T. maritima components to identify specific structural elements contributing to thermostability.

  • Evolution-guided mutagenesis: Based on phylogenetic analysis, introduce ancestral or derived mutations to trace the evolutionary trajectory of thermoadaptation.

  • Whole-system bioenergetic analysis: Study the integration of ATP synthase within the complete bioenergetic machinery of T. maritima, which includes:

    • The Rnf complex (a Na+-coupled respiratory enzyme)

    • Ferredoxin-linked metabolism

    • H2 production pathways

    This approach reveals how individual components have co-evolved to maintain energetic efficiency under extreme conditions .

  • Membrane composition effects: Examine how different lipid environments affect the function of T. maritima ATP synthase, revealing adaptations to membrane fluidity at high temperatures.

Research has shown that in T. maritima, the ATP synthase works in conjunction with the Rnf complex to build a simple, two-limb respiratory chain using Na+ as the coupling ion . This represents a unique adaptation to hyperthermophilic conditions and provides insights into diverse bioenergetic strategies across the temperature spectrum.

What methods are most effective for studying the interaction between T. maritima ATP synthase and other components of the energy conservation system?

To effectively study the interactions between T. maritima ATP synthase and other components of the energy conservation system, several specialized techniques can be employed:

  • Co-purification and protein-protein interaction studies: During purification of the ATP synthase from native T. maritima, it frequently co-purifies with the Rnf complex, suggesting a physical or functional association. Native PAGE analysis reveals a 550-kDa ATP synthase complex and Rnf complex bands that can be further analyzed for interaction partners .

  • Pull-down assays with recombinant components: Use tagged recombinant ATP synthase subunit b to identify interaction partners by mass spectrometry. This approach has revealed interactions with components of the Rnf complex and other membrane proteins involved in energy metabolism.

  • Reconstitution of multi-component systems: Co-reconstitute purified ATP synthase and Rnf complex into liposomes to study their functional coupling. Experimental data shows that this reconstituted system can perform Na+ transport coupled to ferredoxin:NAD+ oxidoreductase activity :

    Table 3: Activities in Reconstituted Multi-Component Liposomes

    ComponentActivity MeasuredValue (U/mg)
    ATP synthaseATPase activity2.6
    Rnf complexFd²⁻:NAD⁺-oxidoreductase1.2
    Combined systemNa⁺ transport upon NAD addition2.5-fold accumulation
  • In vivo studies using genetic approaches: Transient gene inactivation and genetic manipulation of ATP synthase components in T. maritima can reveal physiological interactions with other energy conservation systems. For example, studies have shown interconnections between sugar transport systems (including MalK3, an ATPase subunit of the maltose transporter) and energy conservation .

  • Membrane potential measurements: Use fluorescent dyes or electrodes to measure Na+ gradients established by the ATP synthase and other components of the energy conservation system.

Research has demonstrated that in T. maritima, the ATP synthase works in concert with the Rnf complex, which oxidizes reduced ferredoxin and reduces NAD+ coupled to Na+ transport across the membrane. This integrated system represents a simple, efficient respiratory chain adapted to hyperthermophilic conditions .

How can researchers leverage T. maritima ATP synthase subunit b to develop thermostable biocatalysts for biotechnological applications?

Researchers can utilize T. maritima ATP synthase subunit b as a foundation for developing thermostable biocatalysts through several innovative approaches:

  • Scaffold engineering: Use the thermostable structural framework of ATP synthase subunit b as a scaffold for designing new enzymes. This involves:

    • Identifying structurally rigid regions that maintain stability at high temperatures

    • Grafting catalytic residues onto these regions to create novel activities

    • Optimizing the positioning of functional groups through iterative design

  • Directed evolution: Apply directed evolution techniques specifically optimized for thermostable proteins:

    • Use high-temperature selection conditions to enrich for thermostable variants

    • Implement error-prone PCR or DNA shuffling to generate diversity

    • Screen libraries under conditions that simultaneously select for catalytic activity and thermostability

  • Chimeric protein design: Create hybrid constructs combining the thermostable properties of T. maritima ATP synthase subunit b with functional domains from other enzymes. For example, researchers have successfully engineered thermostable enzymes by replacing flexible regions in mesophilic proteins with corresponding segments from thermophilic homologs.

  • Computational design: Employ computational methods to predict stabilizing mutations or design entirely new functions:

    • Use Rosetta or similar platforms to model protein stability at elevated temperatures

    • Identify potential active site configurations compatible with the thermostable scaffold

    • Validate predictions through experimental testing

  • Immobilization strategies: Develop methods for immobilizing engineered biocatalysts based on the T. maritima scaffold:

    • Covalent attachment to thermostable supports

    • Encapsulation in thermoresistant matrices

    • Self-assembly into ordered nanostructures that enhance stability

Evidence supporting this approach comes from successful engineering of other T. maritima proteins. For example, T. maritima β-glucosidase BglB has been successfully modified and expressed in other organisms while maintaining its thermostability and catalytic function . Similar principles could be applied to ATP synthase subunit b to develop novel thermostable biocatalysts.

What are the most significant challenges in studying T. maritima ATP synthase structure-function relationships, and how might they be overcome?

Researchers face several significant challenges when studying T. maritima ATP synthase structure-function relationships, along with potential solutions:

  • Challenge: Membrane protein expression and purification

    The hydrophobic nature of ATP synthase subunit b makes heterologous expression and purification technically demanding.

    Solutions:

    • Optimize expression using specialized E. coli strains designed for membrane proteins

    • Employ fusion partners that enhance membrane insertion and folding

    • Develop detergent screening protocols to identify optimal solubilization conditions

    • Consider cell-free expression systems that have been successful for other membrane proteins

  • Challenge: Maintaining native structure during analysis

    Ensuring that the isolated protein maintains its native conformation outside the membrane environment is difficult.

    Solutions:

    • Use nanodiscs or native-like lipid environments for structural studies

    • Implement cryoEM techniques that have revolutionized membrane protein structural biology

    • Apply hydrogen-deuterium exchange mass spectrometry to examine conformational dynamics

    • Develop on-membrane or in-membrane analytical techniques

  • Challenge: Reconstitution into functional complexes

    Assembling purified components into functional ATP synthase complexes is technically challenging.

    Solutions:

    • Develop co-expression systems for multiple ATP synthase subunits

    • Optimize reconstitution protocols using thermostable lipids

    • Utilize the natural co-purification of ATP synthase with other respiratory complexes as an advantage

    • Implement stepwise assembly protocols validated by functional assays

  • Challenge: High-temperature experimentation

    Conducting experiments at the physiological temperatures of T. maritima (80°C) presents technical obstacles.

    Solutions:

    • Design specialized equipment for high-temperature enzymatic assays

    • Develop thermostable fluorescent probes and sensors

    • Implement microfluidic systems that can withstand elevated temperatures

    • Use computational modeling to bridge experimental gaps at extreme temperatures

  • Challenge: Distinguishing sodium from proton coupling

    Definitively demonstrating Na+ versus H+ coupling mechanisms requires specialized approaches.

    Solutions:

    • Combine isotope labeling (22Na+) with highly sensitive detection methods

    • Develop Na+-specific fluorescent indicators compatible with high temperatures

    • Use DCCD inhibition coupled with Na+ competition studies

    • Apply site-directed mutagenesis to modify predicted Na+-binding sites

Research has shown that innovative approaches, such as those used to demonstrate Na+ transport by the Rnf-ATP synthase supercomplex in reconstituted liposomes, can overcome many of these challenges . By combining multiple complementary techniques and developing specialized tools for thermophilic proteins, researchers can generate comprehensive insights into the structure-function relationships of T. maritima ATP synthase.

How can understanding T. maritima ATP synthase contribute to metabolic engineering for enhanced biofuel production?

Understanding T. maritima ATP synthase and its role in energy metabolism provides valuable insights for metabolic engineering aimed at enhanced biofuel production, particularly hydrogen:

  • Optimizing energy conservation pathways: T. maritima has evolved efficient energy conservation mechanisms operating at high temperatures. Research has demonstrated that its ATP synthase works in concert with the Rnf complex as a two-component respiratory chain using Na+ as the coupling ion . Understanding these energy coupling mechanisms allows for:

    • Rational redesign of bioenergetic pathways in production organisms

    • Balancing ATP production with reducing equivalent generation

    • Improving the thermodynamic efficiency of biofuel-producing pathways

  • Engineering for hydrogen overproduction: Studies on T. maritima have revealed connections between sugar metabolism, ATP synthesis, and hydrogen production. Specifically, mutations in maltose transport (MalK3) led to strains that produced hydrogen above the physiological limit while consuming less maltose and oxidizing it more efficiently :

    Table 4: Hydrogen Production in T. maritima Strains

    StrainH₂ Production (Relative to WT)CO₂ ProductionAcetate Production
    Wild-type100%100%100%
    Tma100 (evolved)118%120%139%
    Tma200 (evolved)148%140%144%

    These findings demonstrate how altering substrate uptake affects energy metabolism and can redirect electron flow toward hydrogen production.

  • Temperature-adapted ATP synthesis: The thermostability of T. maritima ATP synthase offers advantages for high-temperature fermentation processes:

    • Reduced cooling costs in industrial bioreactors

    • Decreased contamination risk at elevated temperatures

    • Improved substrate solubility and reaction kinetics

    • Potential for direct transfer of thermostable components to production organisms

  • Na+ versus H+ bioenergetics: T. maritima's use of Na+ gradients rather than proton gradients represents an alternative bioenergetic strategy that could be advantageous in certain production environments:

    • Reduced proton gradient sensitivity at high temperatures

    • Potential for operating at wider pH ranges

    • Separation of pH homeostasis from energy conservation

Research indicates that in T. maritima, hydrogen production exceeding 4 mol H₂/mol glucose is thermodynamically favorable under normal cultivation conditions, but wild-type organisms preferentially synthesize biomass rather than hydrogen . By understanding and modifying the energy conservation system, including ATP synthase, researchers can develop strains that redirect metabolism toward enhanced biofuel production.

What molecular techniques are most effective for investigating the role of ATP synthase in the broader energy metabolism of T. maritima?

Several specialized molecular techniques have proven particularly effective for investigating the role of ATP synthase in T. maritima's broader energy metabolism:

  • Genetic manipulation systems:

    • Transient gene inactivation: This approach has been successfully used to create unstable recombinants that, upon passage, result in evolved cell lines with altered energy metabolism. For example, disruption of lactate dehydrogenase (ldh) led to the isolation of strains (Tma200) that produced hydrogen at levels above the physiological limit .

    • Single-crossover homologous recombination: This technique allows for targeted gene disruption using a truncated gene fused to a selection marker .

    • Gene replacement and repair: To verify phenotypes are due to specific mutations, genetic repair through recombination can restore wild-type function .

  • Metabolic flux analysis:

    • Radioactive isotope tracing: [14C]maltose transport assays have been used to demonstrate reduced sugar uptake rates in hydrogen-overproducing strains .

    • Metabolite quantification: Comprehensive analysis of fermentation products (H₂, CO₂, acetate, lactate) allows for detailed carbon and electron balancing :

    Table 5: Stoichiometry of Maltose Catabolism in T. maritima Strains

    ParameterWild-typeTma100Tma200
    H₂/glucose (mol/mol)~4.05.426.09
    Carbon recovery (%)93.881.578.3
    Electron recovery (%)93.384.279.7
  • Thermodynamic analysis:

    • Gibbs free energy calculations: Analysis of the thermodynamic feasibility of metabolic pathways under different conditions. For T. maritima growing at 80°C, the ΔG°' for glucose fermentation is approximately -274 kJ/mol (compared to -216 kJ/mol at 25°C) .

    • ATP yield determination: Correlating hydrogen production with ATP generation potential.

  • Membrane potential measurements:

    • Fluorescent probes: Use of potential-sensitive dyes compatible with high temperatures.

    • Ion-selective electrodes: Direct measurement of Na+ gradients established by the ATP synthase.

  • Transcriptomic and proteomic analysis:

    • RNA-Seq: Analysis of gene expression changes in response to different growth conditions. Research has shown that genes like mbxA and nsr are significantly upregulated after sulfur addition, while rnfC shows less pronounced changes .

    • Protein complex analysis: Native PAGE combined with activity staining and mass spectrometry to identify interacting partners of ATP synthase .

These molecular techniques have revealed that T. maritima's ATP synthase functions within a complex energy metabolism network that includes multiple pathways for electron disposal (H₂ production, lactate formation, sulfur reduction) and ion-coupled energy conservation systems (Rnf complex, MBX complex) . Understanding these interactions is critical for metabolic engineering applications targeting enhanced biofuel production.

How does T. maritima ATP synthase subunit b compare structurally and functionally with homologs from other extremophiles?

Comparative analysis of T. maritima ATP synthase subunit b with homologs from other extremophiles reveals important evolutionary adaptations to extreme environments:

  • Thermophilic adaptations:

    T. maritima ATP synthase subunit b exhibits specific structural features that contribute to thermostability when compared to mesophilic homologs:

    • Higher proportion of charged residues forming salt bridges

    • Increased hydrophobic core packing

    • Reduced number of thermolabile residues (Asn, Gln, Cys, Met)

    • Strategic placement of proline residues to reduce conformational flexibility

    Compared to other thermophilic bacteria like Thermus thermophilus, T. maritima ATP synthase shows both convergent and divergent adaptations to high temperature.

  • Ion specificity comparisons:

    Unlike many bacterial ATP synthases that use H⁺ as the coupling ion, T. maritima ATP synthase uses Na⁺ . This differs from some other extremophiles:

    • Acidophiles: Typically maintain H⁺-coupled ATP synthases despite high external proton concentrations

    • Alkaliphiles: Often use modified H⁺-coupled ATP synthases with specialized adaptations

    • Other thermophiles: Variable, with some using H⁺ and others using Na⁺

    Na⁺ coupling may provide advantages at high temperatures where membrane permeability to protons increases.

  • Membrane integration strategies:

    T. maritima ATP synthase subunit b spans the membrane with a single transmembrane helix, followed by a cytoplasmic domain. This topology is conserved in bacteria but shows specific adaptations in different extremophiles:

    • The T. maritima sequence MGFLEINWTSAAMLMLFVLMVYFLNK represents the transmembrane segment

    • This region contains more hydrophobic residues than mesophilic counterparts

    • The composition reflects adaptation to T. maritima's unique membrane lipid composition

  • Regulatory mechanisms:

    Comparisons with other extremophiles reveal diverse regulatory strategies:

    • Some archaeal extremophiles show distinct regulatory subunits not found in T. maritima

    • The coupling of ATP synthase to other respiratory complexes (like the Rnf complex in T. maritima) represents a specific adaptation strategy

    • Regulatory responses to stress conditions vary across extremophile species

  • Evolutionary considerations:

    Phylogenetic analysis places T. maritima ATP synthase in a distinct evolutionary context:

    • While T. maritima is a deeply branching bacterial lineage, its ATP synthase shares core features with other bacterial F-type ATP synthases

    • Some features show unexpected similarities with archaeal A-type ATP synthases

    • This positioning provides insights into the evolution of energy conservation mechanisms

These comparative analyses highlight the diverse strategies extremophiles have evolved to maintain efficient energy conversion under challenging environmental conditions, with T. maritima representing a unique adaptation to life at high temperatures using Na⁺-based bioenergetics.

What insights from T. maritima ATP synthase research apply to understanding bioenergetic adaptations across extremophile systems?

Research on T. maritima ATP synthase has yielded several broadly applicable insights into bioenergetic adaptations across extremophile systems:

  • Modular adaptability of energy conservation systems:

    T. maritima demonstrates how core bioenergetic machinery can be adapted to extreme conditions through specific modifications rather than complete redesign. The ATP synthase maintains its fundamental rotary mechanism while incorporating adaptations for thermostability and Na⁺ coupling . This principle of modular adaptation appears across diverse extremophiles, where conserved energy conservation components are modified for specific environmental challenges.

  • Integration of respiratory complexes:

    The functional and physical coupling between T. maritima ATP synthase and the Rnf complex represents an efficient solution for energy conservation . This kind of integration of respiratory complexes is emerging as a common theme across extremophiles, where:

    • Supercomplexes enhance efficiency under energy-limited conditions

    • Co-regulation ensures balanced operation of coupled systems

    • Physical proximity minimizes energy losses during electron and ion transfer

  • Alternative coupling ions as adaptive strategies:

    T. maritima's use of Na⁺ rather than H⁺ as the coupling ion for ATP synthesis represents a significant adaptation with parallels in other extremophiles :

    • Alkaliphiles may use Na⁺ at high external pH

    • Acidophiles maintain proton gradients despite extreme external acidity

    • Halophiles have evolved specialized adaptations for functioning in high salt

    The choice of coupling ion appears to be an important adaptive variable across environmental extremes.

  • Thermodynamic constraints and adaptations:

    Studies on T. maritima have revealed how thermodynamic constraints shape metabolism at high temperatures. For example, hydrogen production in T. maritima is thermodynamically more favorable at elevated temperatures (ΔG°' of -274 kJ/mol at 80°C versus -216 kJ/mol at 25°C) . This principle helps explain diverse metabolic adaptations across extremophiles, where:

    • Pathways may be reorganized to maximize energy conservation

    • Alternative electron acceptors may be recruited based on redox potential

    • Energy conservation thresholds differ based on environmental conditions

  • Metabolic flexibility as an adaptation strategy:

    T. maritima demonstrates remarkable metabolic flexibility, capable of using diverse carbon sources and electron acceptors. This flexibility extends to its energy conservation system, where the ATP synthase works with different electron transport complexes depending on conditions . Similar flexibility is observed across extremophile systems as a strategy for survival in variable or extreme environments.

  • Evolutionary implications:

    The study of T. maritima ATP synthase provides insights into the evolution of energy conservation systems:

    • The Na⁺-coupling mechanism may represent either an ancestral trait or a specific adaptation

    • The deep evolutionary position of Thermotogae provides perspective on the diversification of bioenergetic systems

    • Comparative analysis across extremophiles reveals both convergent and divergent evolutionary solutions

These insights from T. maritima research have broad applicability for understanding bioenergetic adaptations across extremophile systems and may guide biotechnological applications seeking to harness these mechanisms for sustainable energy production or industrial processes under extreme conditions.

What are the most promising unexplored aspects of T. maritima ATP synthase that warrant further investigation?

Several promising aspects of T. maritima ATP synthase remain unexplored and warrant further investigation:

  • High-resolution structural characterization:

    Despite extensive biochemical characterization, high-resolution structures of T. maritima ATP synthase components, including subunit b, remain limited. Future research should focus on:

    • Cryo-EM studies of the complete ATP synthase complex under physiologically relevant conditions

    • X-ray crystallography of individual subunits and subcomplexes

    • NMR studies of dynamics and conformational changes, particularly at temperatures mimicking T. maritima's natural environment

    • Investigation of potential structural variations during different catalytic states

  • Na+ binding and translocation mechanism:

    While Na+ dependence has been established , molecular details of ion binding and translocation remain incompletely understood:

    • Identification of precise Na+ binding sites through mutational and spectroscopic approaches

    • Elucidation of the complete Na+ translocation pathway

    • Investigation of potential secondary ion specificity (H+ vs. Na+) under different conditions

    • Exploration of the evolutionary transition between H+ and Na+ specificity

  • Regulatory mechanisms under different growth conditions:

    T. maritima encounters variable conditions in its natural environment, suggesting the existence of regulatory mechanisms for ATP synthase:

    • Transcriptional regulation under different carbon sources and electron acceptors

    • Post-translational modifications affecting activity or assembly

    • Protein-protein interactions modulating function

    • Physiological responses to varying Na+ concentrations and temperature fluctuations

  • Supercomplex formation and dynamics:

    The interaction between ATP synthase and other respiratory complexes like the Rnf complex raises questions about supercomplex formation:

    • Structural basis of supercomplex assembly

    • Dynamic association/dissociation under different conditions

    • Functional advantages of physical coupling

    • Potential for additional, undiscovered interaction partners

  • Engineering applications:

    The unique properties of T. maritima ATP synthase offer opportunities for biotechnological applications:

    • Development of thermostable, Na+-driven ATP regeneration systems

    • Creation of hybrid energy conservation systems combining components from different extremophiles

    • Application in bioelectrochemical systems operating at elevated temperatures

    • Use as a platform for directed evolution of novel functionalities

  • Ecological and physiological significance:

    The natural role of Na+-coupled ATP synthesis in T. maritima's native environment remains incompletely understood:

    • Competitive advantages in hydrothermal environments

    • Role in maintaining intracellular pH and ion homeostasis

    • Significance for survival during temperature fluctuations

    • Contribution to ecological fitness in diverse habitats

These unexplored aspects represent significant opportunities for advancing our understanding of bioenergetic systems in extremophiles and may lead to novel biotechnological applications leveraging the unique properties of T. maritima ATP synthase.

How might emerging technologies advance our understanding of T. maritima ATP synthase function and applications?

Emerging technologies offer exciting possibilities for advancing our understanding of T. maritima ATP synthase function and developing novel applications:

  • Single-molecule techniques:

    Next-generation single-molecule approaches can provide unprecedented insights into ATP synthase dynamics:

    • High-speed atomic force microscopy (HS-AFM) to visualize conformational changes in real-time

    • Single-molecule FRET to track subunit movements during catalysis

    • Magnetic tweezers or optical traps to measure forces during rotary catalysis

    • Nanodiscs combined with single-particle tracking to study behavior in membrane environments

    These approaches could reveal how T. maritima ATP synthase maintains functionality at extreme temperatures where molecular motion is accelerated.

  • Advanced structural biology methods:

    Recent advances in structural determination offer new opportunities:

    • Cryo-electron tomography to visualize ATP synthase in native membrane environments

    • Integrative structural biology combining multiple data types (crystallography, NMR, SAXS, mass spectrometry)

    • Time-resolved crystallography to capture transient states during catalysis

    • AlphaFold and similar AI-based prediction tools to model subunit interactions and dynamics

  • Synthetic biology approaches:

    Synthetic biology provides tools for engineering and understanding ATP synthase:

    • CRISPR-based genome editing to create precise mutations in T. maritima

    • Cell-free expression systems optimized for thermophilic proteins

    • Minimal synthetic cells incorporating T. maritima ATP synthase components

    • Chimeric constructs combining features from different extremophiles

  • Advanced microscopy and imaging:

    Novel imaging technologies enable visualization at unprecedented resolution:

    • Super-resolution microscopy to visualize ATP synthase distribution and organization

    • Correlative light and electron microscopy (CLEM) to link structure and function

    • Label-free imaging techniques compatible with high temperatures

    • In situ cryo-electron microscopy to visualize native complexes

  • Nanotechnology integration:

    Integration with nanotechnology offers exciting application possibilities:

    • Bioelectronic devices powered by T. maritima ATP synthase

    • Nanostructured surfaces for oriented immobilization of ATP synthase

    • Nanoscale sensors for monitoring ATP synthesis activity

    • Artificial vesicles with reconstituted ATP synthase for energy conversion applications

  • Multi-omics approaches:

    Comprehensive -omics studies can reveal system-level insights:

    • Integrative transcriptomics, proteomics, and metabolomics under diverse conditions

    • Protein-protein interaction networks centered on ATP synthase

    • Evolutionary genomics to track adaptations across thermophilic lineages

    • Comparative systems biology across extremophiles with different energy conservation strategies

  • Microfluidic and high-throughput platforms:

    Advanced microfluidic systems enable new experimental approaches:

    • Droplet microfluidics for high-throughput activity screening

    • Gradient platforms to test function across temperature and ion concentration ranges

    • Microfluidic devices compatible with high-temperature operation

    • Lab-on-a-chip integration of ATP synthesis with other enzymatic pathways

These emerging technologies, particularly when used in combination, promise to revolutionize our understanding of T. maritima ATP synthase and open new avenues for applications in sustainable energy production, thermostable biocatalysis, and bionanotechnology.

What are the key practical considerations for researchers beginning work with T. maritima ATP synthase?

Researchers beginning work with T. maritima ATP synthase should consider several practical factors to ensure successful experiments:

  • Protein stability and storage considerations:

    T. maritima proteins require specific conditions to maintain stability:

    • Store purified protein in Tris-based buffer with 50% glycerol at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles as they compromise protein integrity

    • Store working aliquots at 4°C for no more than one week

    • Consider adding reducing agents if the protein contains critical cysteine residues

  • Expression and purification challenges:

    Several practical challenges must be addressed:

    • Codon optimization may be necessary for efficient expression in E. coli

    • Use specialized E. coli strains designed for membrane protein expression

    • Consider expressing with a His-tag to facilitate purification

    • Optimize detergent selection for membrane protein solubilization

    • The ATP synthase often co-purifies with other membrane complexes like the Rnf complex, which may complicate purification

  • Activity assay considerations:

    Assay design must account for T. maritima's unique properties:

    • ATPase activity is strictly Na+-dependent with a Km of approximately 1.2 ± 0.2 mM Na+

    • Temperature optimization is critical—activity increases with temperature up to 80°C

    • Standard assay temperatures (45-60°C) represent a compromise between protein activity and stability of assay components

    • DCCD inhibition can be used to confirm ATP synthase activity, with Na+ competition relieving inhibition

  • Reconstitution parameters:

    For functional studies in liposomes:

    • Select lipids with appropriate phase transition temperatures

    • Consider using archaeal lipids or synthetic alternatives stable at high temperatures

    • Optimize protein:lipid ratios (typical starting ratios: 1:50 to 1:100 w/w)

    • Carefully control detergent removal rates during reconstitution

    • Verify reconstitution success through freeze-fracture electron microscopy or dynamic light scattering

  • Equipment requirements:

    Working with thermophilic proteins requires specialized equipment:

    • Temperature-controlled spectrophotometers for activity assays

    • Heat blocks or water baths capable of stable 80°C operation

    • Thermostable pH electrodes for buffer preparation

    • Consider using anoxic chambers for reconstitution experiments as T. maritima is an anaerobe

  • Expression vector selection:

    The choice of expression system impacts success:

    • pET-based vectors show good expression levels for T. maritima proteins

    • Consider vectors with tightly controlled induction to prevent toxicity

    • Fusion partners (MBP, SUMO) may improve solubility

    • Evaluate both C- and N-terminal tag positions to optimize expression and activity

These practical considerations address the major challenges researchers face when beginning work with T. maritima ATP synthase and will help ensure experimental success with this valuable but technically demanding protein system.

How should researchers approach troubleshooting common issues when working with recombinant T. maritima ATP synthase subunit b?

Researchers may encounter several common issues when working with recombinant T. maritima ATP synthase subunit b. Here's a systematic approach to troubleshooting these challenges:

  • Poor expression yields:

    Problem signs: Low protein bands on SDS-PAGE, weak Western blot signal

    Troubleshooting approach:

    • Optimize codon usage for the expression host

    • Try different E. coli expression strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta)

    • Reduce induction temperature (18-25°C) and extend expression time

    • Test different induction OD600 values (0.4-0.8)

    • Consider auto-induction media which often improves membrane protein expression

    • Verify mRNA expression by RT-PCR to determine if the issue is transcriptional or translational

  • Protein aggregation:

    Problem signs: Protein in inclusion bodies, precipitation during purification

    Troubleshooting approach:

    • Optimize detergent selection—try a panel of detergents (DDM, LDAO, OG)

    • Add stabilizing agents (glycerol 10-20%, specific lipids, osmoprotectants)

    • Consider fusion partners known to enhance solubility (MBP, SUMO, Trx)

    • Implement on-column refolding protocols if recovering from inclusion bodies

    • Test expression at lower temperatures to allow proper membrane insertion

    • For the ATP synthase subunit b specifically, ensure buffer contains sufficient Na+ (1-5 mM) as this can stabilize structure

  • Loss of activity during purification:

    Problem signs: Decreasing specific activity across purification steps

    Troubleshooting approach:

    • Minimize time between purification steps

    • Add protease inhibitors to prevent degradation

    • Maintain appropriate ion concentrations (Na+ for T. maritima ATP synthase)

    • Consider mild detergents that better preserve protein-lipid interactions

    • Add small amounts of lipids to purification buffers

    • Implement activity assays after each purification step to identify problematic conditions

    • Consider adding reducing agents if oxidation affects function

  • Reconstitution failures:

    Problem signs: No measurable activity after liposome reconstitution

    Troubleshooting approach:

    • Optimize protein:lipid ratios (try 1:20 to 1:200 w/w range)

    • Test different reconstitution methods (detergent dialysis, Bio-Beads, cyclodextrin)

    • Verify liposome formation by dynamic light scattering

    • Ensure proper orientation by using freeze-thaw cycles

    • Add specific lipids that may be required for activity

    • Confirm protein incorporation by density gradient centrifugation

    • Try different buffer compositions for the reconstitution process

  • Inconsistent activity measurements:

    Problem signs: High variability between experimental replicates

    Troubleshooting approach:

    • Standardize temperature control precisely (±0.5°C)

    • Ensure Na+ concentrations are precisely controlled

    • Prepare fresh ATP solutions for each experiment

    • Implement internal standards in activity assays

    • Consider effects of protein concentration on activity (potential oligomerization)

    • Standardize handling times between preparation and measurement

    • Use the same batch of liposomes for comparative experiments

  • Protein degradation:

    Problem signs: Multiple bands on SDS-PAGE, decreasing molecular weight over time

    Troubleshooting approach:

    • Add protease inhibitor cocktails optimized for thermophilic proteins

    • Store at optimal temperatures (avoid room temperature storage)

    • Minimize freeze-thaw cycles by preparing single-use aliquots

    • Consider adding glycerol (50%) for long-term storage

    • Implement rigorous quality control testing before experiments

    • For working solutions, store at 4°C for no more than one week

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.