Recombinant Thermotoga maritima Magnesium transport protein CorA (corA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
corA; TM_0561; Cobalt/magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-351
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
corA
Target Protein Sequence
MEEKRLSAKKGLPPGTLVYTGKYREDFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPT WINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLH ELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDD YFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELRKTIWPLREVLSSLYRDVP PLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATI FMPLTFIAGIYGMNFEYMPELRWKWGYPVVLAVMGVIAVIMVVYFKKKKWL
Uniprot No.

Target Background

Function
This protein mediates the influx of magnesium ions and cobalt(II) uptake, exhibiting high selectivity for Co(II). It functions through an open-closed state alternation, activated by low cytoplasmic Mg(II) levels and inactivated when cytoplasmic Mg(II) levels are high.
Gene References Into Functions
  1. Research has highlighted the crucial role of Leu294 in the CorA protein for Mg2+ transport gating. PMID: 21074514
Database Links

KEGG: tma:TM0561

STRING: 243274.TM0561

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the basic structure of Thermotoga maritima CorA protein?

    Thermotoga maritima CorA (TmCorA) is a homopentameric membrane protein with fivefold symmetry around a central pore. The structure can be divided into three major parts: a transmembrane domain (TMD), a stalk helix connecting the TMD to the intracellular domain (ICD), and a large cytoplasmic funnel domain (ICD). The transmembrane region contains two α-helices per protomer (TM1 and TM2) arranged as inner and outer pentamers. The periplasmic entrance to the pore contains the conserved GMN (Gly-Met-Asn) motif that acts as a selectivity filter by binding to Mg²⁺ via its first hydration shell . The ICD contains ten inter-protomer binding sites for Mg²⁺ (two per protomer, denoted M1 and M2) that regulate channel gating .

  • What ion selectivity does TmCorA demonstrate?

    TmCorA transports several divalent cations with varying affinities. Functional assays using reconstituted proteoliposomes have demonstrated that TmCorA readily transports Mg²⁺, Co²⁺, Ni²⁺, and Zn²⁺, but not trivalent ions such as Al³⁺ . Interestingly, some studies have shown that TmCorA has a preference for Co²⁺ over Mg²⁺, which appears to be controlled by the presence of threonine side chains in the channel . The selectivity is believed to be influenced by both the GMN motif at the periplasmic entrance and a series of polar residues in the transmembrane region that coordinate with partially hydrated ions during transport .

  • What techniques are commonly used to express and purify recombinant TmCorA?

    Recombinant TmCorA is typically expressed in E. coli expression systems using vectors containing the TmCorA gene. The protein is often expressed with an affinity tag (such as His-tag) for purification using Ni²⁺-nitrilotriacetate (Ni-NTA) chromatography. Detergents like dodecyl maltoside (DDM) are used to solubilize the membrane protein during extraction and purification. The purified protein can then be reconstituted into liposomes or nanodiscs for functional studies or crystallized for structural determination. Researchers often use thermostability as an advantage when working with TmCorA, as it comes from a thermophilic organism and retains function after heating steps that can help eliminate less stable contaminant proteins .

  • How does Mg²⁺ concentration affect the gating of TmCorA?

    TmCorA gating is regulated by intracellular Mg²⁺ concentration through binding to the regulatory sites in the ICD. At high Mg²⁺ concentrations (>20 mM), TmCorA adopts a rigid symmetric conformation representing a closed state. As Mg²⁺ concentration decreases (2-3 mM), the channel exhibits dynamic asymmetric conformations. In the absence of Mg²⁺, several distinct rigid asymmetric conformations can be observed . The binding of Mg²⁺ to the regulatory sites causes conformational changes that are transmitted to the transmembrane domain, converting an open hydrophilic pore into a closed hydrophobic one through a helical rotation mechanism .

Table 1: Ion Transport Properties of TmCorA

IonTransportRelative AffinityInhibition by Co(III) Hexamine
Mg²⁺YesModerateStrong
Co²⁺YesHighStrong
Ni²⁺YesModerateStrong
Zn²⁺YesModerateStrong
Al³⁺NoN/AN/A
Ca²⁺LimitedLowModerate

Based on data from references and

Table 2: Key Residues in TmCorA Function

ResidueLocationFunctionEffect of Mutation
Gly312Selectivity filterPart of GMN motifDisrupts transport
Met313Selectivity filterPart of GMN motifDisrupts transport
Asn314Selectivity filterPart of GMN motif, forms constriction ringAbolishes selectivity
Tyr311Pore entranceAromatic stacking with Phe315Destabilizes selectivity filter
Phe315Pore entranceAromatic stacking with Tyr311Destabilizes selectivity filter
E316/E320Interhelical loopBinding sites for cationsReduces ion binding
Asn288TM1Polar residue for hydrated ion coordinationN288L mutation aborts transport
Thr295TM1Polar residue for hydrated ion coordinationT295L mutation aborts transport
Thr299TM1Polar residue for hydrated ion coordinationT299L mutation aborts transport
Met291Pore constrictionForms hydrophobic gate with Leu294Affects gating
Leu294Pore constrictionForms hydrophobic gate with Met291Affects gating

Based on data from references , , and

Table 3: Structural States of TmCorA and Corresponding Conditions

StateMg²⁺ ConcentrationSymmetryDynamicsFunction
Closed>20 mMSymmetricRigidNon-conducting
Intermediate2-3 mMAsymmetricDynamicPartially conducting
OpenAbsentAsymmetricMultiple statesConducting
Inhibited (Co(III) Hexamine)N/ASymmetricRigidNon-conducting

Based on data from references and

  • What methods can be used to measure real-time ion transport through TmCorA in experimental systems?

    Several methodological approaches can be implemented to measure real-time ion transport through TmCorA:

    1. Fluorescence-based transport assays:

      • Reconstitute TmCorA into proteoliposomes loaded with fluorescent ion indicators

      • Use indicators like Mag-Fura-2 for Mg²⁺ or FluoZin-1 for Zn²⁺ that change fluorescence upon ion binding

      • Monitor fluorescence changes in real-time using a plate reader or spectrofluorometer

      • Calculate transport rates by calibrating fluorescence signals against known ion concentrations

    2. Electrophysiological measurements:

      • Incorporate TmCorA into planar lipid bilayers

      • Perform patch-clamp recordings to measure single-channel currents

      • Use different voltage protocols to determine voltage-dependence of transport

      • Apply different ion concentrations to measure concentration-dependence

    3. Radioactive ion flux measurements:

      • Use isotopes like ⁶³Ni, ²⁸Mg, or ⁶⁵Zn

      • Measure uptake into proteoliposomes containing TmCorA

      • Filter proteoliposomes at different time points and quantify radioactivity

      • Calculate flux rates based on time-dependent accumulation

    4. Membrane potential measurements:

      • Use voltage-sensitive dyes like DiSC3(5) to monitor membrane potential changes

      • Correlate membrane potential changes with ion transport activity

      • Test the effect of ionophores and inhibitors on transport rates

    These methods can be combined with mutational studies and inhibitor screens to provide comprehensive insights into the transport mechanism of TmCorA .

  • How do the transport mechanisms differ between TmCorA and other members of the CorA family?

    While the CorA family shares structural similarities, there are notable differences in transport mechanisms:

    1. Driving force for transport:

      • TmCorA and most CorA proteins: Transport is stimulated primarily by membrane potential

      • ZntB (a CorA family member): Transport is stimulated by proton gradients

    2. Ion selectivity:

      • Variation in selectivity among family members is controlled by differences in the pore-lining residues

      • TmCorA shows preference for Co²⁺ over Mg²⁺, controlled by threonine residues in the channel

      • Other CorA members have different ion preferences depending on pore composition

    3. Regulatory mechanisms:

      • Conservation of the basic regulatory mechanism involving metal binding to intracellular sites

      • Variations in the number and arrangement of regulatory sites among different family members

      • Differences in the sensitivity to Mg²⁺ concentration between bacterial, archaeal, and eukaryotic mitochondrial CorA proteins

    4. Structural differences:

      • Variations in the interhelical loops and second signature motif

      • TmCorA contains the conserved region EYMPEL (where MPEL is the second signature motif)

      • MjCorA contains SYLPLA (less conserved within the family)

    These differences reflect evolutionary adaptation to different cellular environments and functional requirements, while maintaining the core pentameric structure and transport mechanism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.