Recombinant Thermotoga maritima Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Insertase Mechanism

  • Substrate Binding: Cytoplasmic loops guide substrates into the hydrophilic groove, where salt bridges (e.g., R72–D7/D18 of Pf3 coat protein) stabilize intermediates .

  • Conformational Dynamics: TM helices widen during insertion, expelling water from the groove to trigger hydrophobic shifts .

  • Energy-Independent Action: Unlike ATP-dependent chaperones, YidC relies on hydrophobic forces and groove hydration for substrate translocation .

Chaperone Activity

  • Rearrangement of TM helices and N-AH repositioning enable YidC to fold membrane proteins post-insertion .

Production and Handling

Recombinant T. maritima YidC (Product Code: CSB-EP895356TNJ1) is produced in E. coli with the following specifications :

ParameterDetail
Purity>85% (SDS-PAGE verified)
Storage-20°C/-80°C (lyophilized form stable for 12 months)
Reconstitution0.1–1.0 mg/mL in deionized water with 5–50% glycerol
Host SystemE. coli
TagDetermined during manufacturing (varies by batch)

Research Applications

  • Molecular Dynamics (MD) Simulations: Used to map hydration-dehydration cycles in the TM groove and salt-bridge dynamics during Pf3 coat protein insertion .

  • X-ray Crystallography: Resolved structural rearrangements in the TM helices and periplasmic domain .

  • In Vivo Crosslinking: Identified lateral exit pathways for substrates (e.g., TM3–TM5 interface in Pf3 coat insertion) .

Mechanistic Insights from Studies

  • Hydration-Driven Insertion: Water molecules in the hydrophilic groove decrease friction for substrate sliding, while dehydration promotes membrane integration .

  • Allosteric Regulation: Removal of the C2 loop disrupts hydrogen bonding (Y516–G429) and salt bridges (K232–D329), impairing TM groove stability .

  • Species-Specificity: N-AH enables functional divergence; T. maritima YidC cannot complement E. coli YidC knockouts due to Sec translocon incompatibility .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development based on your specification.
Synonyms
yidC; TM_1461; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
yidC
Target Protein Sequence
MVLRKVVAILLAILPIFLFAVEPIKVVRSEKEIVVLTRFEEYHFDLEKGILKDFYTLVDG RKHVFTYGNDGFDVLDEGTPLTVIEEPIVTGVGKVSEGFSDEVSIVYNYGYVKKIFTIKN NENYTFFVDIESSKPVDVTVPRVSVDTSTDRYLENYFASFNPKTRTLVLLKHDEGLLFEG TLKVNGQKRFIVFMGPNKRTLIKKAFPEDYDVLIKALVNIPGFNKWYDSVFYGLVWFFWW LKDLTKNFGWAIMLFTLIVRLILYPLYHAQTKSLINMRKLQPQIEAIKKKYKDPTKQQEA LLKLYREAGVNPASGCLMLLIQLPIFMLLWSVIRYYVEEFAYSGSFLIWKDLSAGGFSNN WLFLVITIVASYYTTLLTSQDARTAWQGIIMSVIFPFLFVGLPSGLFLYYATNTLIQLAV TYYTYKRYKIKGLTTRELLGLPKKA
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as certain lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: tma:TM1461

STRING: 243274.TM1461

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Thermotoga maritima YidC and what is its fundamental role in cellular biology?

    Thermotoga maritima YidC belongs to the evolutionarily conserved YidC/Oxa1/Alb3 family of proteins that facilitates the insertion, folding, and assembly of α-helical membrane proteins across all kingdoms of life . TmYidC functions as a membrane protein insertase that provides a hydrophilic microenvironment within the membrane, reducing the energetic costs of membrane protein traversal . Unlike the SecY translocon that forms a complete transmembrane channel, TmYidC utilizes a hydrophilic groove that creates a specialized environment for membrane protein insertion .

  • How does the structure of TmYidC compare to other bacterial YidC homologs?

    The crystal structure of full-length TmYidC, resolved at 3.8 Å, reveals a monomeric form with a conserved core domain consisting of two loosely associated α-helical bundles . The TmYidC periplasmic domain (TmPD) has a β-supersandwich fold but with notably shortened β strands and different connectivity compared to Escherichia coli YidC (EcYidC) . While sharing the fundamental architecture of other YidC homologs, TmYidC exhibits structural adaptations that likely reflect its thermophilic nature, distinguished from the archaeal YidC-like DUF106 protein .

  • What are the key functional domains of TmYidC and their roles in membrane protein insertion?

    TmYidC contains several critical functional domains:

    DomainStructureFunction
    Core domainTwo loosely associated α-helical bundlesForms the hydrophilic groove essential for insertase activity
    Periplasmic domain (TmPD)β-supersandwich fold with shortened β strandsMay be involved in substrate recognition and polar localization
    Transmembrane helicesFive primary TM segmentsAnchors the protein in the membrane; TM3-TM5 forms an exit site for substrates
    Hydrophilic grooveWater-accessible cavity in the membraneProvides favorable environment for substrate insertion

    These domains work together to facilitate the specialized function of guiding membrane proteins into the lipid bilayer without forming a complete transmembrane channel .

Advanced Research Questions

  • What is the precise molecular mechanism by which TmYidC facilitates membrane protein insertion?

    TmYidC facilitates membrane protein insertion through a channel-independent mechanism that utilizes a hydrophilic microenvironment rather than a complete transmembrane pore . The mechanism involves:

    1. Initial recognition of the substrate's hydrophilic segments or negatively charged N-terminus

    2. Attraction to the water-accessible cavity containing a conserved arginine residue (analogous to R366 in EcYidC) that faces the hydrophobic lipid core

    3. Sliding of the substrate along YidC's hydrophilic groove, which provides favorable interactions for charged and polar residues

    4. Lateral release of the substrate into the membrane bilayer via the TM3-TM5 interface, as demonstrated by in vivo photo-crosslinking experiments

    5. Significant rearrangement of the two α-helical bundles at the top of the hydrophilic groove, shown to be critical for function through engineered intramolecular disulfide bonds

    This mechanism allows YidC to reduce the energy barrier for membrane traversal while maintaining the membrane's barrier function to other molecules .

  • How does TmYidC's structure reflect its adaptation to thermophilic conditions?

    As a protein from the thermophilic bacterium Thermotoga maritima, TmYidC has evolved specific structural adaptations that maintain stability and function at high temperatures (60-90°C) . Comparative proteomic analysis has revealed that T. maritima proteins, including TmYidC, respond differently to temperature changes compared to other thermophiles such as T. tengcongensis . Key adaptations in TmYidC include:

    • Modified β-strand organization in the periplasmic domain with shorter strands and altered connectivity compared to mesophilic homologs

    • Potentially enhanced hydrophobic core packing in the transmembrane regions

    • Optimized electrostatic interactions that contribute to thermal stability

    • Possible association with chaperone proteins like heat shock protein 60 and elongation factor Tu, which are upregulated at higher temperatures

    These structural adaptations enable TmYidC to maintain its insertase function across the broad temperature range (60-90°C) of T. maritima's natural environment .

  • What is the evolutionary relationship between YidC and the SecY translocon?

    Recent research suggests a unified evolutionary origin for YidC and SecY, with compelling evidence that SecY may have originated from a YidC homolog . Key findings supporting this hypothesis include:

    1. Both proteins facilitate the diffusion of hydrophilic protein segments across the hydrophobic membrane by burying hydrophilic groups inside the membrane

    2. SecY could have evolved from YidC through a process where two hydrophilic grooves were juxtaposed in an antiparallel homodimer to form a channel

    3. The structural features of YidC's hydrophilic groove are recognizable in SecY with similar functional roles

    4. The hydrophobic end of YidC's hydrophilic groove corresponds to SecY's pore ring, where the hydrophilic vestibules from each side of the membrane connect

    This evolutionary relationship explains why YidC can function both independently and cooperatively with the Sec apparatus in membrane protein biogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.