Recombinant Thermotoga maritima Methyl-accepting chemotaxis protein 2 (mcp2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mcp2; TM_1143; Methyl-accepting chemotaxis protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-530
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
mcp2
Target Protein Sequence
MSLKGKTLLVSTITLAAVVLVALLGGSVFLKAGQNVRKAFEEYELAVEALDKLGELETKV ALFVNNAAKIEEVSSLFNELKKVADKIPSLKEHMDALERNISEIISGKTEVVSRIQSSVD QVKEDIMANLDRTRENLDKEISYSSELIRNVLFIVLPIVAVASGVFLFVMISRSLRLLKP VMEASRSLRNNDLTINIQEAKGKDEISTLLNEFKASIEYLRNNLKDVQTETFSVAESIEE ISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASF ADQSTQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQT NLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVS SEITARVEEGTKLADEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENA KNAEEITNSVKEVNARLQEISASTEEVTSRVQTIRENVQMLKEIVARYKI
Uniprot No.

Target Background

Function

Methyl-accepting chemotaxis proteins (MCPs) are signal transducers that respond to environmental attractant and repellent concentration changes. They transduce extracellular signals into intracellular responses and facilitate sensory adaptation through methylation level variations.

Database Links

KEGG: tma:TM1143

STRING: 243274.TM1143

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermotoga maritima Methyl-accepting chemotaxis protein 2 (Mcp2)?

Thermotoga maritima Methyl-accepting chemotaxis protein 2 (Mcp2) is a full-length protein (530 amino acids) that functions as a chemoreceptor in the bacterial chemotaxis signaling pathway. This protein belongs to the hyperthermophilic bacterium T. maritima, which thrives in near-boiling aqueous environments. The protein is encoded by the mcp2 gene (also annotated as TM_1143) in the T. maritima genome . As a chemoreceptor, Mcp2 plays a crucial role in sensing environmental chemical signals and transducing them to the intracellular signaling components, ultimately controlling the swimming behavior of the bacterium in response to attractants or repellents.

The Mcp2 protein contains multiple functional domains, including a transmembrane region that anchors it in the cell membrane, a periplasmic ligand-binding domain that detects chemical signals, and a cytoplasmic signaling domain that interacts with other chemotaxis proteins. The full amino acid sequence reveals characteristic features of methyl-accepting chemotaxis proteins, including methylation sites that are subject to modification by methyltransferases and methylesterases during adaptation to chemical stimuli .

What are the structural characteristics of T. maritima Mcp2?

The T. maritima Mcp2 protein exhibits several key structural characteristics that are essential for its function:

  • Transmembrane arrangement: The protein contains transmembrane helices that anchor it in the bacterial membrane. Analysis of the amino acid sequence indicates a structure with hydrophobic membrane-spanning regions, particularly evident in the N-terminal portion of the protein (MSLKGKTLLVSTITLAAVVLVALLGGSVFLKAG) .

  • Cytoplasmic signaling domain: The C-terminal portion of the protein forms a coiled-coil structure that interacts with the histidine kinase CheA and the coupling protein CheW to form a signaling complex.

  • Methylation sites: The protein contains multiple glutamate residues that serve as sites for methylation/demethylation during the adaptation process. These sites are regulated by the activities of CheR (methyltransferase) and CheB (methylesterase) .

  • Similar to other MCPs, Mcp2 likely forms homodimers that further assemble into trimers of dimers in the bacterial membrane, creating a hexagonal array that amplifies the sensitivity of the chemotaxis system.

The thermostability of T. maritima Mcp2, like other proteins from this hyperthermophile, is likely enhanced through extensive ionic interactions, tight hydrophobic packing, and structural adaptations that allow it to maintain its functional conformation at high temperatures (up to 90°C) .

How does the methylation/demethylation cycle regulate T. maritima Mcp2 function?

The methylation/demethylation cycle is a critical regulatory mechanism for chemoreceptor function in bacteria, including T. maritima Mcp2. This process modulates the sensitivity of the chemoreceptor to chemical stimuli and enables bacterial adaptation to persistent stimuli.

The cycle involves two enzymes:

  • CheR (methyltransferase): Adds methyl groups to specific glutamate residues on the chemoreceptor.

  • CheB (methylesterase): Removes methyl groups from these same sites.

These differences are significant because the CheB demethylation consensus sites on the chemoreceptors are not uniquely conserved between T. maritima and S. typhimurium. The surfaces with differing electrostatic properties likely reflect CheB regions that mediate protein-protein interaction with the chemoreceptor. Computational docking studies of T. maritima and S. typhimurium CheB structures to their respective chemoreceptors have provided insights into the CheB:chemoreceptor interaction mode .

What are the optimal expression systems for recombinant T. maritima Mcp2 production?

For optimal expression of recombinant T. maritima Mcp2, Escherichia coli-based expression systems have proven effective, as demonstrated by successful production of His-tagged full-length Mcp2 protein . When designing an expression strategy, researchers should consider the following methodological approaches:

  • Expression vector selection: Vectors containing strong inducible promoters (such as T7) are recommended, as they allow controlled expression of the hyperthermophilic protein.

  • Host strain considerations: E. coli BL21(DE3) or its derivatives are typically used for expressing T. maritima proteins due to their reduced protease activity and T7 RNA polymerase expression system .

  • Induction parameters: Optimal induction conditions for T. maritima proteins often include:

    • Lower induction temperatures (16-25°C) to promote proper folding

    • Moderate IPTG concentrations (0.2-0.5 mM)

    • Extended expression times (overnight)

  • Fusion tags: The addition of an N-terminal His-tag has been successfully used for T. maritima Mcp2 expression and subsequent purification . This approach allows for efficient one-step purification using immobilized metal affinity chromatography (IMAC).

  • Codon optimization: Considering the codon usage bias between T. maritima and E. coli, codon optimization of the mcp2 gene for expression in E. coli can significantly improve protein yields.

When expressing membrane proteins like Mcp2, researchers may need to evaluate different approaches to obtain properly folded protein, including:

  • Expression of only the soluble domains

  • Use of specialized E. coli strains for membrane protein expression

  • Addition of membrane-mimicking environments during purification

How should recombinant T. maritima Mcp2 be stored and handled in the laboratory?

Based on experience with recombinant T. maritima Mcp2 and similar proteins, the following storage and handling procedures are recommended:

What purification strategies yield the highest purity for T. maritima Mcp2?

To achieve high purity (>90%) of recombinant T. maritima Mcp2, the following purification strategy has been successfully implemented:

  • Initial capture: Immobilized Metal Affinity Chromatography (IMAC) using the N-terminal His-tag is the primary method for capturing the recombinant protein from E. coli lysates . This step typically involves:

    • Bacterial cell lysis under native conditions (sonication or high-pressure homogenization)

    • Clarification of lysate by centrifugation

    • IMAC purification using Ni-NTA or similar resin

    • Gradient elution with increasing imidazole concentrations

  • Secondary purification: Following IMAC, additional purification steps may include:

    • Size Exclusion Chromatography (SEC) to separate monomeric protein from aggregates and to remove remaining impurities

    • Ion Exchange Chromatography (IEX) as a polishing step to achieve >90% purity

  • Quality assessment: SDS-PAGE analysis is the standard method to verify protein purity, with successful purification showing a predominant band at approximately 58 kDa (530 amino acids plus His-tag) .

  • Special considerations for membrane proteins:

    • Addition of mild detergents (such as n-dodecyl-β-D-maltoside) during purification to maintain proper folding of transmembrane domains

    • Reconstitution into nanodiscs or liposomes for functional studies

This multi-step purification approach consistently yields T. maritima Mcp2 with greater than 90% purity as determined by SDS-PAGE analysis, suitable for structural and functional studies .

How does the thermostability of T. maritima Mcp2 compare to other chemoreceptors?

The thermostability of T. maritima Mcp2, like other proteins from this hyperthermophilic organism, is significantly higher than that of mesophilic counterparts. While specific melting temperature data for Mcp2 is not directly available in the search results, insights can be drawn from studies of other T. maritima proteins.

For example, the T. maritima acyl carrier protein (Tm-ACP) demonstrates exceptional thermostability with a melting temperature of 101.4°C, which far exceeds that of ACPs from mesophilic organisms . This thermostability is achieved through several mechanisms:

  • Extensive ionic interactions: The formation of salt bridges and ionic networks provides significant stabilization of the protein structure at high temperatures .

  • Tight hydrophobic packing: Enhanced hydrophobic interactions in the protein core contribute to structural stability .

  • Hydrogen bonding networks: Extended hydrogen bonding patterns help maintain secondary structure elements.

  • Reduced flexibility in loop regions: Shorter loops and increased rigidity in certain protein regions reduce the entropy of unfolding.

By analogy, T. maritima Mcp2 likely employs similar strategies to maintain its structure and function at temperatures approaching 90°C. Analysis of the Mcp2 amino acid sequence reveals features consistent with thermostable proteins, including a higher proportion of charged residues that can form ionic interactions, and a well-balanced distribution of hydrophobic residues that can contribute to core packing .

Comparative studies of chemoreceptors from psychrophilic, mesophilic, and thermophilic organisms would provide valuable insights into the evolutionary adaptations that enable these proteins to function across different temperature ranges.

What protein-protein interactions are critical for T. maritima Mcp2 function?

The function of T. maritima Mcp2 depends on specific protein-protein interactions within the chemotaxis signaling pathway. Key interactions include:

  • Mcp2-CheW interaction: CheW acts as a coupling protein that connects chemoreceptors like Mcp2 to the histidine kinase CheA. This interaction is essential for signal transduction and forms the core of the chemotaxis signaling complex.

  • Mcp2-CheA interaction: The histidine kinase CheA interacts with the cytoplasmic domain of Mcp2, either directly or through CheW. This interaction regulates CheA autophosphorylation activity in response to chemoreceptor conformational changes.

  • Mcp2-CheR interaction: The methyltransferase CheR recognizes specific sites on the Mcp2 cytoplasmic domain for methylation, which is critical for adaptation to persistent stimuli.

  • Mcp2-CheB interaction: The methylesterase CheB interacts with Mcp2 to remove methyl groups during the adaptation process. This interaction has species-specific characteristics. Crystal structure analysis of T. maritima CheB methylesterase domain has revealed that despite having identical topology to its S. typhimurium counterpart, there are considerable differences in electrostatic potential surface near the catalytic triad . These differences likely reflect adaptations in the CheB regions that mediate protein-protein interaction with Mcp2 and other chemoreceptors.

  • Mcp2-Mcp2 interactions: Chemoreceptors like Mcp2 form homodimers that further assemble into trimers of dimers, creating a hexagonal array that amplifies the sensitivity of the chemotaxis system. These higher-order structures are stabilized through specific protein-protein interactions between adjacent chemoreceptor molecules.

Computational docking studies have provided insights into the interaction mode between CheB and chemoreceptors in T. maritima, highlighting the importance of electrostatic complementarity in these interactions . Understanding these protein-protein interactions is essential for elucidating the molecular mechanisms of chemotaxis signaling in T. maritima.

How can structural knowledge of T. maritima Mcp2 inform protein engineering efforts?

Structural knowledge of T. maritima Mcp2 provides valuable insights for protein engineering efforts, particularly in the following areas:

  • Thermostability engineering: Understanding the structural features that contribute to the exceptional thermostability of T. maritima Mcp2 can guide efforts to engineer increased thermostability in mesophilic proteins. Key principles include:

    • Introduction of ionic networks similar to those observed in T. maritima proteins

    • Optimization of hydrophobic core packing

    • Strategic placement of proline residues to reduce backbone flexibility

  • Receptor specificity modification: Knowledge of the ligand-binding domain structure can inform efforts to modify the specificity of chemoreceptors for biotechnological applications, such as:

    • Development of biosensors for specific compounds

    • Creation of bacteria with altered chemotactic responses for bioremediation

    • Engineering microbes with novel taxis behaviors for specific applications

  • Adaptation mechanism engineering: Understanding the methylation sites and their structural context can guide efforts to modify the adaptation kinetics of chemoreceptors, potentially creating systems with altered sensitivity or response dynamics.

  • Protein-protein interaction optimization: Insights into the interfaces between Mcp2 and other chemotaxis proteins can inform efforts to optimize or redesign these interactions for synthetic biology applications.

  • Thermal adaptation studies: Comparative analysis of T. maritima Mcp2 with mesophilic counterparts can reveal key adaptations for function at high temperatures, which has implications for understanding protein evolution and adaptation to extreme environments.

The full-length amino acid sequence of T. maritima Mcp2 (1-530 aa) provides a foundation for structure-based protein engineering approaches . The sequence contains information about the protein's domain organization, potential sites for modification, and residues involved in critical interactions.

How does T. maritima Mcp2 differ from similar proteins in other Thermotoga species?

  • Genomic context: While the mcp2 gene is present in most Thermotoga species, its genomic context may differ, potentially affecting its regulation and co-expression with other chemotaxis genes.

  • Sequence variations: Comparison of Mcp2 across different Thermotoga species (T. maritima, T. petrophila, T. neapolitana, and Thermotoga sp. strain RQ2) would reveal specific amino acid substitutions that might be associated with adaptations to different environmental niches .

  • Expression patterns: Transcriptomic analyses using a Thermotoga multispecies cDNA microarray have shown that different Thermotoga species exhibit distinct gene expression patterns when grown on various carbohydrates . These differences in regulation may extend to chemotaxis genes, including mcp2.

  • Functional adaptations: Different Thermotoga species have been isolated from various high-temperature environments (marine hydrothermal vents, continental oil reservoirs, etc.), which may exert different selective pressures on chemotaxis proteins, leading to functional adaptations in Mcp2.

  • Ligand specificity: Variations in the periplasmic sensing domain of Mcp2 across Thermotoga species might reflect adaptations to detect different chemoattractants or chemorepellents relevant to their specific ecological niches.

It's worth noting that while all Thermotoga species share the core metabolic pathways (glycolytic, pentose phosphate, and Entner-Doudoroff), there are species-specific variations in certain enzymes . By analogy, we might expect similar conservation of core functions in Mcp2 across species, with variations in specific regions that influence ligand specificity or interaction with other components of the chemotaxis pathway.

What can T. maritima Mcp2 teach us about protein adaptation to extreme environments?

T. maritima Mcp2, as a protein from a hyperthermophilic organism, provides valuable insights into molecular adaptations to extreme environments:

The analysis of the amino acid sequence and structural features of T. maritima Mcp2 contributes to our understanding of protein adaptation to extreme environments and can inform efforts to engineer proteins with enhanced thermostability for various biotechnological applications .

What are the specific challenges in working with hyperthermophilic proteins like T. maritima Mcp2?

Working with hyperthermophilic proteins like T. maritima Mcp2 presents several unique challenges that researchers should be aware of:

  • Expression in mesophilic hosts: When expressing T. maritima Mcp2 in E. coli or other mesophilic expression systems, researchers may encounter:

    • Codon usage bias affecting translation efficiency

    • Potential toxicity due to improper folding at lower temperatures

    • Formation of inclusion bodies requiring refolding procedures

  • Purification considerations:

    • Standard purification protocols may need modification to accommodate the unusual stability of hyperthermophilic proteins

    • Heat treatment (incubation at 70-80°C) can be used as a purification step to denature E. coli proteins while leaving T. maritima proteins intact

    • Buffer conditions optimized for mesophilic proteins may not be optimal for T. maritima Mcp2

  • Activity assays:

    • Functional assays must be conducted at or near the physiological temperature of T. maritima (approximately 80°C)

    • Standard assay components (buffers, coupling enzymes, etc.) may not be stable at these temperatures

    • Special equipment (high-temperature incubators, thermostable cuvettes, etc.) may be required

  • Structural studies:

    • Crystallization conditions successful for mesophilic proteins may not work for thermophilic counterparts

    • NMR studies must account for different dynamics at elevated temperatures

    • Sample preparation methods may need to be adapted for the unusual stability of these proteins

  • Storage and handling:

    • While T. maritima proteins are generally more stable than their mesophilic counterparts, proper storage is still essential

    • Recommended storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • For long-term storage, addition of glycerol (final concentration of 50%) and storage at -20°C/-80°C

    • Working aliquots can be maintained at 4°C for up to one week

Despite these challenges, the exceptional stability of T. maritima proteins can also be advantageous, allowing for experimental approaches that would not be possible with less stable proteins. The successful expression and purification of recombinant T. maritima Mcp2 with greater than 90% purity, as determined by SDS-PAGE, demonstrates that these challenges can be overcome with appropriate methodological approaches .

How can functional assays be designed to study T. maritima Mcp2 activity?

Designing functional assays for T. maritima Mcp2 requires careful consideration of its role in chemotaxis and the high-temperature environment in which it naturally functions. Here are methodological approaches for studying different aspects of Mcp2 activity:

  • Ligand binding assays:

    • Isothermal Titration Calorimetry (ITC) conducted at elevated temperatures (60-80°C) to measure binding affinities of potential ligands

    • Fluorescence-based assays using environmentally sensitive fluorophores attached to strategic positions in the Mcp2 structure

    • Surface Plasmon Resonance (SPR) with temperature control to assess binding kinetics

  • Methylation/demethylation assays:

    • Radiolabeled methyl group incorporation assays using purified CheR methyltransferase and S-adenosylmethionine (SAM)

    • Mass spectrometry to identify and quantify methylated sites

    • Methylesterase activity assays using purified CheB and methylated Mcp2

  • Protein-protein interaction assays:

    • Pull-down assays using His-tagged Mcp2 to identify interaction partners

    • Förster Resonance Energy Transfer (FRET) between labeled Mcp2 and other chemotaxis proteins

    • Bacterial two-hybrid systems adapted for thermophilic proteins

    • Microscale Thermophoresis (MST) to measure binding affinities at elevated temperatures

  • Structural response assays:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes upon ligand binding

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling to monitor structural transitions

    • Disulfide cross-linking assays to capture different conformational states

  • In vivo functional complementation:

    • Expression of T. maritima Mcp2 in chemoreceptor-deficient E. coli strains

    • Chemotaxis assays (swarm plates, capillary assays) at the highest temperatures compatible with E. coli survival

    • Development of thermophilic bacterial systems for in vivo studies at higher temperatures

When designing these assays, it's essential to consider the high optimal growth temperature of T. maritima (approximately 80°C) and ensure that assay components remain stable and functional under these conditions. For in vitro assays, buffers containing thermostable components should be used, and experimental equipment must be capable of maintaining stable high temperatures throughout the measurement period.

The integration of multiple assay types provides a comprehensive understanding of T. maritima Mcp2 function, from molecular interactions to cellular responses, in the context of its adaptation to extreme thermal environments.

What are the current gaps in our understanding of T. maritima Mcp2 function and structure?

Despite advances in our understanding of T. maritima Mcp2, several significant knowledge gaps remain that represent opportunities for future research:

  • Ligand specificity:

    • The specific chemotactic signals detected by T. maritima Mcp2 remain largely uncharacterized

    • The structure of the periplasmic sensing domain in complex with its natural ligands has not been determined

    • The relationship between environmental cues relevant to T. maritima's ecological niche and Mcp2 ligand specificity is poorly understood

  • Structural dynamics:

    • The conformational changes that occur during signal transduction, particularly at high temperatures, have not been fully elucidated

    • The impact of temperature on the dynamics and flexibility of different Mcp2 domains remains to be characterized

    • The mechanism by which conformational changes in the periplasmic domain are transmitted across the membrane to the cytoplasmic domain needs further investigation

  • Integration into signaling arrays:

    • The organization of T. maritima chemoreceptors into higher-order arrays and the role of Mcp2 in these structures

    • The potential co-localization of Mcp2 with other chemoreceptors and their cooperative interactions

    • The impact of extreme temperatures on the stability and dynamics of chemoreceptor arrays

  • Adaptation mechanisms:

    • The precise methylation sites on T. maritima Mcp2 and their role in adaptation

    • The kinetics of methylation/demethylation at high temperatures

    • The interplay between different adaptation mechanisms in T. maritima's chemotaxis system

  • Evolutionary aspects:

    • The evolutionary trajectory of Mcp2 in the Thermotoga genus and its relationship to environmental adaptation

    • Comparative analysis with chemoreceptors from other thermophilic bacteria to identify conserved thermal adaptation strategies

    • The potential role of horizontal gene transfer in the evolution of T. maritima's chemotaxis system

Addressing these knowledge gaps would significantly advance our understanding of how chemotaxis functions in extreme environments and could provide insights into the evolution of sensory systems and protein thermostability. The availability of recombinant T. maritima Mcp2 protein with high purity (>90%) provides a valuable resource for researchers addressing these questions through a combination of structural, biochemical, and genetic approaches.

What innovative methodologies could advance research on T. maritima Mcp2?

Advancing research on T. maritima Mcp2 requires innovative methodological approaches that address the challenges of working with hyperthermophilic proteins and provide new insights into their structure, function, and dynamics. Here are some cutting-edge methodologies that could drive significant progress in this field:

  • Cryo-electron microscopy (cryo-EM) at multiple temperatures:

    • Visualization of Mcp2 in its native membrane environment

    • Structural characterization of Mcp2 within the context of chemoreceptor arrays

    • Comparative analysis of structures at different temperatures to understand thermal adaptations

  • Advanced NMR approaches:

    • High-temperature NMR studies to characterize protein dynamics under near-physiological conditions

    • Solid-state NMR of reconstituted Mcp2 in membrane mimetics

    • Relaxation dispersion experiments to capture transient conformational states

  • Integrative structural biology:

    • Combining X-ray crystallography, cryo-EM, NMR, and computational methods to build comprehensive models of Mcp2 function

    • Small-angle X-ray scattering (SAXS) to characterize conformational ensembles at different temperatures

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes and protein-protein interaction interfaces

  • Single-molecule approaches:

    • Single-molecule FRET to monitor conformational changes in real-time

    • Optical tweezers or atomic force microscopy to measure folding/unfolding energetics at different temperatures

    • Single-particle tracking in reconstituted systems to monitor dynamics of receptor clustering

  • Synthetic biology and genetic tools:

    • Development of genetic systems for T. maritima to enable in vivo studies

    • Creation of chimeric receptors combining domains from T. maritima Mcp2 and mesophilic chemoreceptors

    • CRISPR-Cas9 based approaches for precise genome editing in thermophiles

  • Advanced computational methods:

    • Molecular dynamics simulations at elevated temperatures to understand protein motion and stability

    • Machine learning approaches to predict ligand specificity and protein-protein interactions

    • Evolutionary coupling analysis to identify co-evolving residues important for function

  • High-throughput approaches:

    • Deep mutational scanning to map sequence-function relationships

    • Microfluidic platforms for rapid screening of ligand interactions

    • Automated crystallization and data collection pipelines optimized for thermophilic proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.