Recombinant Thermotoga maritima Methyl-accepting chemotaxis protein 3 (mcp3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mcp3; TM_1146; Methyl-accepting chemotaxis protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
mcp3
Target Protein Sequence
MKSVASKLLLGFGLVCAGLVLFGLLTFYNILSLEKIVADTANINRAIVELAINQAGVLVA VQNKDKSLLSSSVEGLRTSLDDIKAYQSDFSGENLKLLQESIAHLEEMIRITDSLIVDGV DQSIYDRFVELQAEIRNPLRKLVQNLGVENVSMTKNIKRNIIFFLVVVCAAAMFIAIFTT RNLTTPLKKLAVLVENLSHGVLNVEIEKIRSKDEIGKAAMAVEKLREILLDIITGINKAS SEVSSSSEELSATSEELSANVNSISEALVSLNKEADENSATLEEFTASIEELSSTADSNS KSAQAMLESTQRVHEQVEKSTERIREITEKAHSTREMSENTKQALNRLLSMAENINSIVD TINSIAEQTNLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESKAATQQIGEILGKLRD EINNSSKIVESTASAIEETASLVESIKDVFESIRIAMEDVQSRVESVAASTQEQSASLEE LSAGVTRLTELLNKTRENTSSANSALQEANAALEELSASAQSLAELAQELQRRIEFFKI
Uniprot No.

Target Background

Function
Chemotactic-signal transducers respond to environmental attractant and repellent concentration changes. They transduce extracellular signals intracellularly and facilitate sensory adaptation through methylation level variation.
Database Links

KEGG: tma:TM1146

STRING: 243274.TM1146

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermotoga maritima Methyl-accepting chemotaxis protein 3 (mcp3)?

Thermotoga maritima mcp3 is a methyl-accepting chemotaxis protein involved in bacterial sensory adaptation and chemotaxis signaling pathways. It belongs to a family of transmembrane chemoreceptors that detect environmental signals and transmit this information to the cytoplasmic signaling machinery. The full-length protein consists of 539 amino acids and contains specific domains for sensing environmental stimuli and signal transduction . In T. maritima, chemoreceptors like mcp3 play critical roles in adaptation during bacterial chemotaxis through reversible methylation of specific glutamate residues within their cytoplasmic domains .

How does recombinant T. maritima mcp3 differ from native protein?

Recombinant T. maritima mcp3 is typically produced with modifications to facilitate purification and characterization. The recombinant version described in the literature features an N-terminal His-tag fusion, which enables efficient purification using affinity chromatography . While the recombinant protein maintains the full-length sequence (amino acids 1-539), the addition of the His-tag may influence certain biophysical properties. The recombinant protein is typically expressed in E. coli expression systems rather than in its native thermophilic host, which may affect post-translational modifications such as methylation patterns .

What expression systems are optimal for recombinant T. maritima mcp3 production?

For successful expression of recombinant T. maritima mcp3, E. coli expression systems have proven effective despite T. maritima being a thermophilic organism . When establishing expression protocols, researchers should consider:

  • Expression vector selection: Vectors providing N-terminal His-tags facilitate purification while maintaining protein functionality

  • E. coli strain optimization: BL21(DE3) or similar strains are commonly used for thermophilic protein expression

  • Induction conditions: Temperature modulation during induction (typically lower than 37°C) can improve folding

  • Solubility enhancement: Addition of solubility-enhancing fusion partners or chaperones may increase yield

The recombinant protein can be obtained in a lyophilized powder form after purification and is typically reconstituted in deionized water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage stability .

What purification strategies yield highest purity and stability for T. maritima mcp3?

A standardized purification workflow for His-tagged recombinant T. maritima mcp3 includes:

Purification StepMethodBuffer ConditionsNotes
Initial CaptureNi-NTA Affinity ChromatographyTris/PBS-based buffer, pH 8.0Exploits N-terminal His-tag
PolishingSize Exclusion ChromatographyTris/PBS-based buffer, pH 8.0Removes aggregates and impurities
Quality ControlSDS-PAGEN/AShould achieve >90% purity
StorageLyophilizationTris/PBS-based buffer with 6% Trehalose, pH 8.0Enhances stability

For optimal stability, the purified protein should be stored at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles which can compromise protein integrity .

How do methylation patterns of T. maritima chemoreceptors differ from mesophilic bacteria?

T. maritima chemoreceptors exhibit distinct methylation patterns compared to their mesophilic counterparts in E. coli and Salmonella enterica. Through liquid chromatography-mass spectrometry/mass spectrometry analysis, researchers have identified 15 specific methylation sites within the cytoplasmic domains of four different T. maritima chemoreceptors . These findings established a consensus sequence for chemoreceptor methylation sites in T. maritima that differs significantly from the previously established consensus for E. coli and S. enterica .

This divergence in methylation patterns highlights an important research consideration: consensus sequences for post-translational modifications established in one bacterial species cannot be directly extrapolated to others, even for highly conserved systems like bacterial chemotaxis . Researchers studying mcp3 should therefore empirically determine methylation sites rather than relying on predictions based on mesophilic bacterial systems.

What thermostability mechanisms enable T. maritima mcp3 function at elevated temperatures?

T. maritima is a hyperthermophilic bacterium with an optimal growth temperature of 80°C . Consequently, its proteins, including mcp3, possess structural adaptations that maintain functionality at these extreme temperatures. While specific thermostability data for mcp3 is limited in the available literature, general thermostability mechanisms in T. maritima proteins include:

  • Higher proportion of charged amino acids forming salt bridges

  • Increased hydrophobic core packing

  • Reduced occurrence of thermolabile amino acids

  • Enhanced secondary structure stabilization

Researchers investigating mcp3 thermostability should incorporate comparative analyses with mesophilic chemoreceptors to identify specific thermal adaptation features. Circular dichroism spectroscopy at varying temperatures can provide insights into thermal unfolding properties and stability thresholds specific to this protein.

What methodological approaches can identify ligands for T. maritima mcp3?

Despite extensive structural characterization of T. maritima chemotaxis proteins, no specific ligands have been identified for its six different transmembrane chemoreceptors, including mcp3 . Researchers seeking to identify potential ligands should consider:

  • Thermal Shift Assays: Screening compound libraries for molecules that alter protein thermal stability

  • Isothermal Titration Calorimetry: Measuring binding thermodynamics at elevated temperatures

  • Bioinformatic Analysis: Comparing periplasmic sensing domains with characterized chemoreceptors

  • Chemotaxis Assays: Developing high-temperature compatible mobility assays to assess chemotactic responses

Since the periplasmic domains of T. maritima chemoreceptors show diversity while cytoplasmic domains are more conserved , efforts should focus on the variable periplasmic regions when investigating ligand specificity.

How can structural studies of T. maritima mcp3 advance understanding of thermophilic adaptation?

Structural characterization of T. maritima mcp3 presents valuable opportunities for understanding protein adaptation to extreme temperatures. T. maritima has already proven to be a useful source of chemotaxis proteins for structural analysis in cases where crystallization of mesophilic orthologs has failed . Research approaches should include:

  • X-ray crystallography of the full-length receptor in different signaling states

  • Cryo-electron microscopy to visualize receptor arrays at high temperatures

  • Molecular dynamics simulations comparing thermostability mechanisms

  • Structure-guided mutagenesis to identify critical residues for thermostability

These studies can reveal fundamental principles of protein thermal adaptation and potentially inspire biotechnological applications requiring thermostable proteins.

What is the role of mcp3 in the broader chemotaxis signaling system of T. maritima?

To understand mcp3's position within the T. maritima chemotaxis system, researchers should investigate its interactions with other chemotaxis proteins. The T. maritima genome encodes not only six different transmembrane chemoreceptors but also the complete set of chemotaxis signaling proteins including CheR (methyltransferase), CheB (methylesterase), CheD (deamidase), and associated proteins CheC and CheX .

Research approaches to elucidate mcp3's role include:

  • Protein-protein interaction studies to map the chemotaxis interactome

  • In vitro reconstitution of signaling complexes

  • Comparative analysis of methylation rates across different chemoreceptors

  • Investigation of receptor clustering and array formation at high temperatures

Understanding these interactions will provide insights into how thermophilic bacteria have adapted chemotaxis signaling mechanisms to function at extreme temperatures.

How can researchers optimize storage conditions for maximal stability of recombinant T. maritima mcp3?

For optimal stability of recombinant T. maritima mcp3, researchers should follow these evidence-based recommendations:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • For working solutions, store aliquots at 4°C for up to one week

The addition of protective agents such as trehalose (typically 6% in storage buffer) enhances stability by preventing protein denaturation during freeze-thaw cycles .

What analytical methods are most suitable for assessing T. maritima mcp3 methylation states?

Given the complexity and specificity of methylation patterns in T. maritima chemoreceptors, researchers should employ sophisticated analytical techniques:

  • Liquid Chromatography-Mass Spectrometry/Mass Spectrometry (LC-MS/MS): This approach has successfully identified 15 methylation sites in T. maritima chemoreceptors and established a consensus sequence distinct from E. coli and S. enterica

  • In vitro Methylation Assays: Using purified T. maritima CheR methyltransferase with recombinant receptors

  • Antibody-based Detection: Developing methylation-specific antibodies for immunoblotting

  • Bioinformatic Analysis: Computational prediction of potential methylation sites based on the T. maritima-specific consensus sequence

When designing these experiments, researchers should account for the potential influences of the His-tag on methylation accessibility and consider comparing methylation patterns between native and recombinant proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.