Recombinant Thermotoga maritima Uncharacterized ABC transporter ATP-binding protein TM_0288 (TM_0288)

Shipped with Ice Packs
In Stock

Description

Overview and Biochemical Properties

Recombinant TM_0288 is produced in E. coli with an N-terminal His tag for purification. Key specifications include:

PropertyDetails
UniProt IDQ9WYC4
Gene NameTM_0288
Protein LengthFull-length (1–598 amino acids)
Molecular Weight~67 kDa (calculated)
Purity>90% (SDS-PAGE)
Storage ConditionsLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water with optional glycerol (5–50%) for stability

The protein is annotated as an "uncharacterized ABC transporter ATP-binding protein," indicating its role in ATP hydrolysis for transport activity, though its specific substrates remain unidentified .

Dynamic Behavior

Molecular dynamics simulations highlight:

  • ATP binding at both NBDs induces dimerization and stabilizes the consensus ATP-binding pocket (ABP2) .

  • Substrate binding enhances ABP2 formation via transmembrane domain (TMD)-NBD allostery .

Functional Insights

Although TM_0288’s exact biological role is unconfirmed, its structural homology to ABC exporters suggests involvement in:

  • Substrate Transport: Likely exports small molecules or ions, leveraging ATP-driven conformational changes .

  • Ion Homeostasis: Structural similarities to NatAB-like Na+ efflux pumps hint at potential ion transport roles .

Research Applications

Recombinant TM_0288 serves as a model system for studying:

  • Heterodimeric ABC Transporters: Its asymmetric ATPase activity mirrors eukaryotic transporters like CFTR and TAP1/2 .

  • Allosteric Mechanisms: Insights into D-loop-mediated communication between degenerate and consensus ATP sites .

  • Thermostability: Derived from T. maritima, the protein retains functionality at high temperatures, aiding structural studies .

Future Directions

Unresolved questions include:

  • Substrate Identification: Biochemical assays to screen potential ligands.

  • Mechanistic Details: Elucidating how TM_0288’s unique apo-state architecture influences transport efficiency.

  • Physiological Role: Genetic studies to link TM_0288 to stress response or metabolic pathways in T. maritima.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TM_0288; Uncharacterized ABC transporter ATP-binding protein TM_0288
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
TM_0288
Target Protein Sequence
MPEIRRRPHGPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLI GKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKL QRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILS LVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEME KFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFI GYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNV WFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIR KIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEG YETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEG KTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKE
Uniprot No.

Target Background

Database Links

KEGG: tma:TM0288

STRING: 243274.TM0288

Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TM_0288 and what is its role in Thermotoga maritima?

TM_0288 is an ATP-binding protein component of the heterodimeric ABC transporter TM287-TM288 found in the hyperthermophilic bacterium Thermotoga maritima. This protein functions as part of the nucleotide binding domain (NBD) of the transporter complex, working in conjunction with TM287 to form a complete transporter. The TM287-TM288 heterodimeric complex is involved in substrate translocation across cell membranes, utilizing the energy from ATP binding and hydrolysis at the NBDs . As part of an ABC exporter, it likely plays a role in exporting various molecules from the cell, contributing to cellular homeostasis in the extreme thermophilic environment where T. maritima thrives.

What are the optimal conditions for expressing recombinant TM_0288?

For optimal expression of recombinant TM_0288, researchers should consider the thermophilic nature of the source organism. Methodologically, expression systems using E. coli BL21(DE3) with a pET-based vector have been successful for related T. maritima proteins. Expression should be induced with IPTG (0.5-1 mM) when cultures reach OD600 of 0.6-0.8, followed by incubation at 25-30°C for 4-6 hours to balance protein yield and proper folding. Purification typically involves immobilized metal affinity chromatography (IMAC) using a histidine tag, followed by size exclusion chromatography to obtain pure protein. For functional studies, it's critical to ensure that the recombinant protein retains its ATP-binding capabilities, which can be verified through nucleotide binding assays.

How does the structure of TM_0288 compare to other ABC transporter proteins?

TM_0288 forms part of the heterodimeric ABC transporter TM287-TM288, which has been characterized through crystallography at 2.9-Å resolution in its inward-facing conformation . Unlike many other ABC transporters where the NBDs completely separate during the transport cycle, the TM287-TM288 structure reveals that the NBDs remain partially in contact through an interface involving conserved motifs that connect the two ATP hydrolysis sites . This structural feature provides unique insights into heterodimeric ABC exporters' mechanisms. The protein shares structural similarities with eukaryotic homologs like CFTR and TAP1-TAP2, particularly in the deviations from consensus sequences at the degenerate catalytic site .

What are the most effective methods for purifying recombinant TM_0288?

The most effective purification strategy for recombinant TM_0288 involves a multi-step approach optimized for thermostable proteins:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins with His-tagged protein

  • Intermediate Purification: Ion exchange chromatography at pH 7.5-8.0 to separate based on charge properties

  • Polishing Step: Size exclusion chromatography using Superdex 200 columns with a buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, and 1 mM DTT

For studying the heterodimeric complex, co-expression of TM_0287 and TM_0288 followed by tandem affinity purification has proven effective. The purification buffers should include 10-20% glycerol to enhance protein stability. A heat treatment step (65-70°C for 15 minutes) can be included before chromatography to leverage the thermostability of the protein and eliminate many E. coli contaminants.

How can researchers effectively analyze the ATP binding and hydrolysis activities of TM_0288?

To analyze ATP binding and hydrolysis activities of TM_0288, researchers should employ multiple complementary approaches:

  • ATP Binding Assays:

    • Fluorescence-based methods using MANT-ATP or TNP-ATP as fluorescent ATP analogs

    • Isothermal titration calorimetry (ITC) to determine binding constants, stoichiometry, and thermodynamic parameters

    • Surface plasmon resonance (SPR) for real-time binding kinetics

  • ATP Hydrolysis Assays:

    • Colorimetric phosphate release assays (malachite green or molybdate-based)

    • Coupled enzyme assays using pyruvate kinase and lactate dehydrogenase to monitor ADP production

    • Thin-layer chromatography to separate ATP and ADP

For TM_0288 specifically, researchers should note that the native heterodimeric TM287-TM288 complex shows AMP-PNP binding to the degenerate catalytic site , suggesting important functional characteristics. Temperature-dependent measurements (25-80°C) are crucial to understand how thermal conditions affect the protein's activity, given T. maritima's hyperthermophilic nature.

What crystallization conditions have been successful for structural studies of TM_0288?

For crystallization of TM_0288 as part of the TM287-TM288 heterodimeric complex, researchers have successfully used the following approach:

  • Protein Preparation: Purified protein at 10-15 mg/mL in a buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and 5 mM β-mercaptoethanol

  • Crystallization Method: Sitting-drop vapor diffusion at 20°C

  • Successful Conditions: Crystallization reservoirs containing:

    • 100 mM HEPES pH 7.0-7.5

    • 10-15% PEG 4000

    • 100-200 mM ammonium sulfate or sodium acetate

    • Addition of 5-10 mM AMP-PNP and 5 mM MgCl₂ to stabilize the nucleotide-bound state

Crystals typically appear within 7-14 days and should be cryoprotected with 20-25% glycerol or ethylene glycol before flash-cooling in liquid nitrogen. The existing structure was determined at 2.9-Å resolution using X-ray crystallography , providing important insights into the inward-facing conformation of this heterodimeric ABC transporter.

How does the TM287-TM288 heterodimer compare to other ABC transporters in terms of NBD separation during the transport cycle?

The TM287-TM288 heterodimer exhibits distinctive NBD behavior during the transport cycle that differentiates it from other ABC transporters. While many ABC transporters undergo complete separation of their NBDs during the transport cycle, crystallographic evidence at 2.9-Å resolution reveals that the TM287-TM288 complex maintains partial contact between NBDs in its inward-facing state .

Comparative Analysis of NBD Separation in ABC Transporters:

ABC TransporterOrganismNBD BehaviorFunctional Implication
TM287-TM288T. maritimaPartial separation with maintained contact through conserved motifsPossible increased efficiency in transport cycle; unique mechanism for heterodimeric transporters
Sav1866S. aureusComplete separation in inward-facing stateClassical alternating access model
CFTRHumansPartial separation (similar to TM287-TM288)Channel function with regulatory mechanisms
TAP1-TAP2HumansAsymmetric behavior similar to TM287-TM288Peptide transport with specialized substrate recognition

This partial separation appears to involve conserved motifs that connect the two ATP hydrolysis sites , suggesting an evolutionary adaptation that may offer insights into the mechanics of heterodimeric ABC exporters. This feature provides a structural basis for understanding similar mechanisms in eukaryotic homologs such as CFTR and TAP1-TAP2, which also feature asymmetric NBDs .

What is the significance of the degenerate catalytic site in TM_0288 and how does it compare to similar sites in eukaryotic ABC transporters?

The degenerate catalytic site in TM_0288 represents a significant structural and functional feature that provides insights into the evolution and mechanism of heterodimeric ABC transporters. As observed in the crystal structure, this site binds AMP-PNP (a non-hydrolyzable ATP analog) and deviates from the consensus sequence in specific positions .

Comparative Analysis of Degenerate Catalytic Sites:

TransporterOrganismDeviations from ConsensusFunctional Consequences
TM287-TM288T. maritimaModified Walker A/B motifs and signature sequenceAsymmetric hydrolysis; possible regulatory role
CFTRHumansSimilar patterns of deviation in NBD1Regulated channel opening; altered hydrolysis kinetics
TAP1-TAP2HumansDeviations in TAP1 matching patterns in TM_0288Specialized peptide transport; asymmetric ATP utilization

Methodologically, researchers can investigate the functional significance of this degenerate site through targeted mutagenesis to restore consensus sequences, followed by transport assays and ATP hydrolysis measurements. Biophysical techniques such as hydrogen-deuterium exchange mass spectrometry can reveal how nucleotide binding at the degenerate site affects conformational dynamics throughout the transporter complex.

The conserved pattern of sequence deviations across prokaryotic and eukaryotic transporters suggests evolutionary importance, possibly providing these transporters with specialized regulatory mechanisms or altered energy coupling for their specific transport functions.

How can molecular dynamics simulations enhance our understanding of TM_0288 function in extreme thermophilic conditions?

Molecular dynamics (MD) simulations offer powerful approaches to understand how TM_0288 maintains functionality under the extreme thermophilic conditions of T. maritima's native environment (optimal growth at 80°C) . Methodologically, researchers should:

  • Simulation Setup:

    • Use the 2.9-Å crystal structure of TM287-TM288 as starting point

    • Embed the protein in a lipid bilayer that mirrors T. maritima's membrane composition

    • Perform simulations at multiple temperatures (25°C, 60°C, 80°C, and 100°C)

    • Run all-atom simulations with explicit solvent for at least 500 ns at each temperature

  • Analysis Focus:

    • Protein stability (RMSD, RMSF, secondary structure persistence)

    • Nucleotide binding pocket conformational changes

    • Water dynamics at the protein-ligand interface

    • Salt-bridge networks and their contribution to thermal stability

    • Inter-domain communication pathways

MD simulations can reveal unique structural adaptations that permit TM_0288 to function at temperatures where mesophilic ABC transporters would denature. For example, simulations might identify thermostability-conferring features such as increased surface charge, additional salt bridges, or optimized hydrophobic packing that remain intact at high temperatures.

What role might TM_0288 play in the stress response mechanisms of Thermotoga maritima?

TM_0288, as part of the TM287-TM288 ABC transporter complex, may contribute to stress response mechanisms in T. maritima, particularly during exposure to oxidative conditions. While no direct evidence links TM_0288 specifically to stress response, studies on related systems in T. maritima provide contextual insights.

T. maritima contains operons that are upregulated under oxidative conditions, such as the operon containing TM0483-TM0486, which encodes an ABC transporter dedicated to thiamin transport . By analogy, the TM287-TM288 transporter might participate in similar stress response mechanisms.

Potential Stress Response Functions:

  • Export of toxic compounds produced during oxidative stress

  • Maintenance of membrane homeostasis under temperature fluctuations

  • Transport of stress-mitigating molecules such as compatible solutes or redox-active compounds

To investigate this hypothesis, researchers should:

  • Perform transcriptomic analysis of T. maritima under various stress conditions to determine if TM_0288 expression is altered

  • Create deletion mutants (if genetic tools are available) to assess survival under stress

  • Conduct transport assays with potential stress-related substrates

  • Analyze protein-protein interactions to identify potential partners involved in stress response pathways

What are the current limitations in expressing and studying TM_0288 in heterologous systems?

Researchers face several challenges when expressing and studying TM_0288 in heterologous systems:

  • Expression Challenges:

    • Obtaining correctly folded protein due to the thermophilic origin (T. maritima grows optimally at 80°C )

    • Potential toxicity to host cells if the transporter integrates into host membranes

    • Codon usage bias between T. maritima and common expression hosts like E. coli

  • Functional Study Limitations:

    • Difficulty in reconstituting the native membrane environment

    • Unknown native substrates for transport assays

    • Need for heterodimerization with TM287 for proper function

    • Temperature-dependent activity may not be observable at standard laboratory conditions

Methodological Solutions:

  • Use specialized expression systems like C41/C43(DE3) E. coli strains designed for membrane protein expression

  • Co-express with TM287 using dual plasmid systems or polycistronic constructs

  • Employ thermostable detergents (DDM, LMNG) for membrane protein extraction

  • Develop high-temperature activity assays compatible with standard laboratory equipment

  • Consider cell-free expression systems that can operate at elevated temperatures

How might the study of TM_0288 and related ABC transporters advance our understanding of membrane protein evolution in extremophiles?

The study of TM_0288 provides a valuable window into the evolution of membrane proteins in extremophiles, particularly how ABC transporters adapt to function in high-temperature environments. T. maritima occupies an interesting evolutionary position, being one of the most thermophilic bacteria and showing substantial horizontal gene transfer with archaea .

Research Approaches:

  • Comparative Genomics:

    • Construct phylogenetic trees of TM_0288 homologs across temperature gradients (psychrophiles to hyperthermophiles)

    • Identify conserved motifs specific to thermophilic variants

    • Map horizontal gene transfer events involving ABC transporters

  • Structure-Function Analysis:

    • Compare TM287-TM288 inward-facing structure with mesophilic counterparts

    • Identify structural features unique to thermophilic ABC transporters

    • Conduct mutagenesis studies to transform thermophilic features to mesophilic proteins and vice versa

  • Molecular Evolution Experiments:

    • Apply directed evolution to TM_0288 under varying temperature conditions

    • Track adaptive mutations that enhance or reduce thermostability

This research could reveal universal principles of protein thermostabilization applicable to protein engineering and shed light on how life adapts to extreme environments, with implications for astrobiology and the search for life in extreme environments.

What computational approaches can predict potential transport substrates for the TM287-TM288 complex?

  • Structure-Based Methods:

    • Molecular docking of compound libraries to the substrate-binding cavity

    • MD simulations to assess binding stability and conformational changes

    • Pharmacophore modeling based on the binding site characteristics

  • Genomic Context Analysis:

    • Examine neighboring genes for functional relationships

    • Identify potential regulatory elements that might indicate substrate class

    • Compare with operonic structures of functionally characterized ABC transporters

  • Machine Learning Approaches:

    • Train models on known ABC transporter-substrate pairs

    • Use sequence and structural features to predict substrate classes

    • Implement transfer learning from better-characterized ABC transporters

Implementation Strategy:

  • Begin with substrate binding pocket analysis from the 2.9-Å crystal structure

  • Generate a focused library of potential substrates based on T. maritima's metabolism and environment

  • Validate top computational predictions using in vitro binding and transport assays

  • Iteratively refine predictions based on experimental feedback

These computational approaches should be considered complementary rather than definitive, with experimental validation essential for confirming actual transport substrates.

How does TM_0288 fit into the broader metabolic network of Thermotoga maritima?

TM_0288, as part of the TM287-TM288 ABC transporter complex, likely plays an integral role in T. maritima's metabolic network by mediating the transport of specific substrates across the cell membrane. Though the exact substrates remain uncharacterized, we can position this transporter within the metabolic framework based on contextual information.

T. maritima is a hyperthermophilic anaerobe that can use carbohydrates and complex organic matter as carbon sources , with the ability to produce biohydrogen through fermentation . The TM287-TM288 transporter may contribute to:

  • Nutrient Acquisition: Potentially importing specific carbohydrates or oligosaccharides that feed into central metabolism

  • Waste Removal: Exporting metabolic byproducts toxic at high accumulation

  • Homeostasis Regulation: Transporting compounds that maintain cellular redox balance under anaerobic conditions

Integration with systems biology approaches could include:

  • Flux balance analysis incorporating transporter constraints

  • Metabolomics studies under conditions where TM_0288 is up/downregulated

  • Network analysis to identify metabolic bottlenecks where transport may be limiting

How can non-coding RNA studies enhance our understanding of TM_0288 regulation?

Recent studies have identified novel non-coding RNAs (ncRNAs) in T. maritima that may regulate gene expression under various conditions . These ncRNAs could potentially regulate TM_0288 expression or function, providing another layer of control over this ABC transporter.

Methodological Approaches:

  • Regulatory Interaction Prediction:

    • Computational analysis to identify potential ncRNA binding sites in the TM_0288 mRNA

    • Secondary structure prediction of the TM_0288 transcript to identify accessible regions

    • Co-expression network analysis to identify ncRNAs whose expression patterns correlate with TM_0288

  • Experimental Validation:

    • RNA-seq under various growth conditions to monitor TM_0288 and ncRNA expression

    • SHAPE-seq to map RNA structure changes in the presence of candidate regulatory ncRNAs

    • Reporter assays to validate regulatory interactions

A study using RNAz and RNA Infernal tools identified 9 novel cis-regulatory small ncRNAs in T. maritima MSB8 , named Tmn (T. maritima ncRNAs). Future research should investigate whether any of these Tmn ncRNAs interact with the TM_0288 transcript or influence its expression under stress conditions.

What insights can proteomics studies provide about TM_0288 expression and interaction partners?

Proteomics approaches offer powerful tools to understand TM_0288's expression patterns, post-translational modifications, and protein-protein interactions within the T. maritima cellular context.

Key Proteomics Methodologies:

  • Expression Profiling:

    • Quantitative proteomics (SILAC, TMT, or label-free) across growth conditions

    • Targeted MRM/PRM assays for sensitive detection of TM_0288

    • Spatial proteomics to confirm membrane localization

  • Interaction Networks:

    • Affinity purification-mass spectrometry using tagged TM_0288

    • Crosslinking mass spectrometry to capture transient interactions

    • Proximity labeling (APEX or BioID adapted for thermophiles)

  • Post-Translational Modifications:

    • Phosphoproteomics to detect regulatory modifications

    • Redox proteomics to identify potential oxidative modifications

    • Analysis of thermostability-enhancing modifications

Research Questions Addressable Through Proteomics:

  • Does TM_0288 expression change under oxidative stress conditions (as seen with other ABC transporters in T. maritima )?

  • What proteins beyond TM287 physically interact with TM_0288?

  • Are there regulatory modifications that control transport activity?

  • Does TM_0288 participate in larger membrane protein complexes?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.