Recombinant Thermotoga maritima Uncharacterized protein TM_1467.1 (TM_1467.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TM_1467.1; Uncharacterized protein TM_1467.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
TM_1467.1
Target Protein Sequence
MMIDVFLIALLLSILTGNIKNVLKYNYKGLYLFAIPFVLQLLPWKEILVPLSFVMLFLFF IWNRNIPGFKLMAIGAVLNGFTMSVNGGKMPVWEPTLKLLNLDLDFKHTAFTEFSWKTLL ADYIPVYLPWGRKFVISVGDILVFIGVFIFFVLKPRFQTQPSRVPHES
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermotoga maritima and why is it important for studying uncharacterized proteins?

Thermotoga maritima is a hyperthermophilic anaerobic bacterium that grows optimally at 80°C. This organism holds significant evolutionary importance as it belongs to the Thermotogae phylum, which is found at the base of the bacterial 16S rRNA gene-based phylogenetic tree. Though the exact phylogenetic depth remains debated, Thermotogae is consistently considered deep-branching and has been the focus of several evolutionary studies .

The significance of T. maritima extends beyond its evolutionary position. As an organism from hydrothermal vent communities, it is thought to harbor traits of early life. T. maritima can convert a diverse range of mono-, di-, and polysaccharides to produce hydrogen with high stoichiometric efficiency, making it valuable for both basic research and biotechnological applications .

The Joint Center of Structural Genomics (JCSG) has conducted a comprehensive structural proteomics project on T. maritima to define the complete set of protein folds and functions within a single organism. This has resulted in direct structural coverage of 37% of expressed soluble proteins (321 unique PDB structures), and when combined with homology and fold recognition models, 72% of the proteome has been covered . This extensive structural characterization makes T. maritima an excellent model for studying uncharacterized proteins.

What is currently known about TM_1467.1 and its potential functions?

TM_1467.1 is classified as an uncharacterized protein from Thermotoga maritima. According to available data, it is a full-length protein consisting of 168 amino acids . Despite the extensive structural coverage of the T. maritima proteome, TM_1467.1 remains functionally uncharacterized.

Unlike some other T. maritima proteins such as TM0486 (which has been shown to bind thiamin and has a ferredoxin-like fold) or TM1442 (which shows amino acid sequence similarity to Bacillus subtilis anti-anti-sigma factors), specific functional information about TM_1467.1 is currently limited .

The lack of assigned function for TM_1467.1 is not unusual; approximately 33% of the 1,868 predicted protein-encoding genes in T. maritima do not have assigned functions . This presents both a challenge and an opportunity for researchers to contribute to fundamental knowledge about this organism's biology.

What expression systems are most effective for producing recombinant TM_1467.1?

Different expression hosts can be used for recombinant TM_1467.1 production, each with distinct advantages. According to available data, E. coli and yeast systems offer the best yields and shorter turnaround times for TM_1467.1 expression . These prokaryotic and lower eukaryotic systems are particularly suitable for basic structural and functional studies where post-translational modifications may not be critical.

For studies requiring post-translational modifications necessary for correct protein folding or activity, expression in insect cells with baculovirus or mammalian cells is recommended . This table summarizes the key considerations for different expression systems:

Expression SystemAdvantagesDisadvantagesRecommended Use Cases
E. coliHigh yields, rapid production, cost-effective, easy to scaleLimited post-translational modifications, potential inclusion body formationInitial characterization, structural studies, antibody production
YeastModerate yields, some eukaryotic PTMs, cost-effectiveMore complex than E. coli, fewer genetic toolsStudies requiring some PTMs, protein interactions
Insect cellsProper folding of complex proteins, many eukaryotic PTMsLower yields, longer production time, more expensiveFunction studies requiring proper folding and modifications
Mammalian cellsFull range of eukaryotic PTMs, native-like foldingLowest yields, longest production time, most expensiveStudies absolutely requiring mammalian-specific modifications

When expressing TM_1467.1, researchers should consider that as a protein from a hyperthermophile, it may require specific considerations for proper folding, even when expressed in mesophilic hosts.

What purification strategies yield the highest purity for recombinant TM_1467.1?

Purification of recombinant TM_1467.1 can be optimized using affinity tags, with His-tagged versions being commonly available . The purification strategy should consider the thermostable nature of this protein.

A recommended purification protocol would include:

  • Affinity chromatography using the His-tag as the primary capture step

  • Heat treatment (taking advantage of TM_1467.1's thermostability to remove host proteins)

  • Size exclusion chromatography for final polishing and buffer exchange

This approach leverages the intrinsic thermal stability of proteins from T. maritima, which can withstand temperatures that denature most proteins from mesophilic expression hosts. For TM_1467.1 specifically, a heat treatment step at 70-75°C for 15-20 minutes can significantly enhance purity with minimal impact on the target protein.

Researchers should monitor the oligomeric state during purification, as some T. maritima proteins exist in multiple states. For example, the TM1442 protein from the same organism exists primarily as both monomer and dimer in solution . Therefore, analytical size exclusion chromatography is recommended to determine the predominant oligomeric state of purified TM_1467.1.

What crystallization conditions should be considered for structural studies of TM_1467.1?

When attempting to crystallize TM_1467.1 for structural studies, researchers should consider approaches that have been successful with other Thermotoga maritima proteins. For example, TM1442 was successfully crystallized using polyethylene glycol (PEG) 8000 as a precipitant .

Based on successful crystallization of other T. maritima proteins, the following conditions provide a starting point:

  • Precipitants: PEG ranges (particularly PEG 8000, PEG 4000)

  • pH range: 6.5-8.5

  • Temperature: Both room temperature and 4°C trials

  • Additives: Divalent cations (Mg²⁺, Ca²⁺) and reducing agents

The dimeric form of TM1442 yielded crystals that diffracted to 2.0 Å resolution, with monoclinic crystals belonging to space group P2(1) . This information provides a potential reference point, although TM_1467.1 may crystallize differently.

For data collection, cryoprotection protocols should be optimized, with data typically collected at 100 K as was done for TM1442 . Researchers should prepare for the possibility that TM_1467.1 may form multiple oligomeric states, which could impact crystallization success.

What bioinformatic approaches are most effective for predicting potential functions of TM_1467.1?

Given the uncharacterized nature of TM_1467.1, computational approaches provide valuable insights before experimental validation. A comprehensive bioinformatic strategy should include:

  • Sequence-based analysis:

    • PSI-BLAST and HHpred for remote homology detection

    • PFAM and InterPro for domain prediction

    • SignalP and TMHMM for cellular localization signals

  • Structure prediction and analysis:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Structural alignment with characterized proteins using DALI or TM-align

    • Active site prediction using CASTp or POCASA

  • Genome context analysis:

    • Examining operonic structure and gene neighborhood

    • Phylogenetic profiling to identify co-evolved proteins

    • Analysis using COG database for ortholog identification across species

The COG database has proven valuable for identifying proteins specific to anaerobic organisms. Previous comparative genome analysis using COGs identified 33 COGs specific to the anaerobic lifestyle, including five corresponding to proteins of unknown function . A similar approach could be applied to understand TM_1467.1's potential role in anaerobic metabolism.

How can protein-protein interaction studies help characterize TM_1467.1 function?

Protein-protein interaction (PPI) studies can provide crucial insights into the biological function of uncharacterized proteins like TM_1467.1. The following methodologies are particularly relevant:

  • Pull-down assays: Using His-tagged TM_1467.1 as bait to identify interaction partners from T. maritima lysate or reconstituted systems.

  • Bacterial two-hybrid systems: Modified for thermophilic proteins to detect interactions at the genetic level.

  • Cross-linking mass spectrometry (XL-MS): To capture transient interactions and determine interaction interfaces.

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics with predicted interaction partners.

When designing PPI experiments for thermophilic proteins, temperature considerations are critical. Interactions should ideally be tested at physiologically relevant temperatures (around 80°C for T. maritima) or with temperature-adapted experimental systems.

The interpretation of PPI data should consider genomic context information. For uncharacterized proteins like TM_1467.1, examining proteins encoded by neighboring genes can provide functional context, as genes involved in related processes are often co-localized in bacterial genomes.

What experimental approaches can verify predicted functions of TM_1467.1?

Verification of predicted functions requires a multi-faceted experimental approach:

  • Biochemical assays: Based on bioinformatic predictions, design assays to test specific enzymatic or binding activities. If structural analysis suggests similarity to known enzymes, corresponding activity assays should be conducted.

  • Gene knockout or knockdown studies: Creating deletion mutants in T. maritima to observe phenotypic effects, though this is technically challenging in hyperthermophiles.

  • Heterologous complementation: Express TM_1467.1 in model organisms with mutations in genes of similar predicted function to test for functional complementation.

  • Substrate screening: Using thermal shift assays (TSA) or differential scanning fluorimetry (DSF) to identify potential substrates that stabilize the protein structure.

  • Structural studies with ligands: Co-crystallization or soaking experiments with predicted substrates or cofactors to identify binding sites, similar to the approach used with TM0486, which revealed binding to thiamin .

When designing these experiments, researchers should account for the thermophilic nature of TM_1467.1, which may affect substrate specificity, cofactor requirements, and reaction conditions compared to mesophilic homologs.

How should temperature conditions be optimized in experimental work with TM_1467.1?

Working with proteins from hyperthermophiles like T. maritima presents unique challenges and opportunities related to temperature optimization:

  • Activity assays: While T. maritima grows optimally at 80°C, functional assays may need to be conducted at various temperatures to determine the thermal activity profile of TM_1467.1. Typically, a range from 60°C to 90°C should be tested.

  • Stability considerations: TM_1467.1 likely exhibits exceptional stability at high temperatures, but researchers should determine the actual temperature range for stability using thermal denaturation studies (e.g., differential scanning calorimetry).

  • Buffer considerations: High-temperature experiments require buffers with minimal temperature dependence in pKa (e.g., phosphate buffers) and increased attention to evaporation during extended incubations.

  • Equipment adaptation: Standard laboratory equipment may require modification for high-temperature experiments. For example, PCR thermocyclers, water baths with condensation covers, and specialized incubators may be needed.

  • Comparative studies: Consider performing parallel experiments with mesophilic homologs (if identified) to understand temperature-dependent functional differences.

The thermostability of TM_1467.1 can be leveraged during purification as a selection step, as mentioned in Question 4, but also presents challenges when designing experiments that accurately reflect the protein's native environment.

What analytical techniques are most appropriate for detecting structural features and modifications in TM_1467.1?

A comprehensive structural characterization of TM_1467.1 requires multiple complementary techniques:

For post-translational modifications, which may be rare in thermophilic bacteria but still possible, liquid chromatography-tandem mass spectrometry (LC-MS/MS) with enrichment strategies for specific modifications (phosphorylation, glycosylation, etc.) should be employed.

The choice of technique should be guided by the specific research question and the existing knowledge gap regarding TM_1467.1 structure and function.

How can researchers resolve contradictory experimental results when studying TM_1467.1?

When facing contradictory results in TM_1467.1 research, a systematic troubleshooting approach is essential:

  • Verify protein identity and integrity:

    • Confirm sequence by mass spectrometry

    • Check for proteolytic degradation using SDS-PAGE and western blotting

    • Verify correct folding using circular dichroism

  • Examine experimental conditions:

    • Temperature dependence of results (critical for thermophilic proteins)

    • Buffer composition effects (pH, salt concentration, reducing agents)

    • Presence of trace contaminants that might affect activity

  • Consider protein oligomeric state:

    • Some T. maritima proteins exist in multiple oligomeric forms with different properties (as seen with TM1442)

    • Verify the oligomeric state under each experimental condition

  • Reproducibility assessment:

    • Use independent protein preparations

    • Vary experimental parameters systematically

    • Consider blind testing by different researchers

  • Reconciliation strategies:

    • Develop integrated models that explain apparent contradictions

    • Consider condition-dependent functional switching

    • Explore multiple functional roles (moonlighting proteins)

Contradictory results often reflect biological reality rather than experimental error. For uncharacterized proteins like TM_1467.1, such contradictions might reveal novel regulatory mechanisms or multiple functions that were not initially anticipated.

What statistical approaches are recommended for analyzing TM_1467.1 functional data?

  • Experimental design considerations:

    • Power analysis to determine appropriate sample size

    • Randomization and blinding where applicable

    • Inclusion of appropriate positive and negative controls

  • Data analysis approaches:

    • For enzymatic kinetics: non-linear regression for parameter determination

    • For binding studies: appropriate models (one-site, two-site, cooperative)

    • For comparative studies: ANOVA with appropriate post-hoc tests

    • For high-throughput screening: statistical correction for multiple testing

  • Validation strategies:

    • Cross-validation techniques for model validation

    • Bootstrap methods for estimating parameter confidence intervals

    • Independent replication of key findings

When presenting results, researchers should follow the general guidance for scientific data presentation: start with response rate and description of experimental conditions, then present key findings and relevant statistical analyses . Statistical significance alone is insufficient; researchers should report effect sizes and confidence intervals to convey the magnitude and precision of observed effects.

How should researchers present structural and functional data for TM_1467.1 in publications?

Effective presentation of TM_1467.1 research follows these principles:

  • General presentation rules:

    • Keep it simple and focused on answering research questions

    • Present general findings before specific details

    • Use past tense for describing results

    • Avoid redundancy between text, tables, and figures

  • Text presentation:

    • Present data interpretation in text rather than raw numbers

    • Avoid qualitative words like "remarkably" or "extremely"

    • Focus on highlighting important patterns and results

  • Table design:

    • Use tables for presenting exact values and comparing multiple parameters

    • Ensure tables are self-explanatory with clear titles and column headers

    • Include statistical measures (p-values, confidence intervals) where appropriate

  • Figure preparation:

    • For structural data: include ribbon diagrams, surface representations, and close-ups of important regions

    • For functional data: use clear graphs with appropriate error bars

    • For sequence analysis: include well-formatted multiple sequence alignments with highlighted conserved regions

  • Supplementary materials:

    • Place extensive datasets or methodological details in supplementary materials

    • Include raw data for reproduction and meta-analysis purposes

Researchers should specifically highlight how their findings on TM_1467.1 contribute to understanding the biology of thermophilic organisms and potentially to broader questions in protein evolution and function.

What approaches are recommended for comparing TM_1467.1 with homologous proteins from other organisms?

Comparative analysis of TM_1467.1 with potential homologs provides evolutionary context and functional insights:

  • Sequence-based comparison:

    • Multiple sequence alignment of putative homologs

    • Phylogenetic analysis to establish evolutionary relationships

    • Conservation analysis to identify functionally important residues

  • Structure-based comparison:

    • Structural alignment using tools like DALI, TM-align, or FATCAT

    • Root-mean-square deviation (RMSD) calculation for quantitative comparison

    • Analysis of conserved structural motifs and potential active sites

  • Functional comparison:

    • Side-by-side biochemical characterization under standardized conditions

    • Analysis of substrate specificity differences

    • Temperature-dependent activity profiles comparison

  • Genomic context comparison:

    • Analysis of gene neighborhood conservation

    • Comparison using COG database, which has been valuable for identifying proteins specific to anaerobic organisms

    • Identification of co-evolved gene clusters across species

  • Experimental validation of predictions:

    • Heterologous complementation studies

    • Domain swapping experiments between homologs

    • Site-directed mutagenesis of predicted functional residues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.