Recombinant Thermotoga maritima Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life depends on numerous factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; upk; TM_0893; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
uppP
Target Protein Sequence
MDLLLGIVQGLTEFLPISSSGHLTLLSHLLKTDLNAYQTAVLHLGTLVSVVLFALDGIRR SLRSWRIILNLIVSTIPAGVFGVLFEKQIDQLFSSPRFLPLFFSATALILMFTRYSSSGE KRMENMSFLDALLVGIAQLFALFPGISRSGITVSSLLFMKYRSEDALQYSFLMSIPVVLG AGILGLGKGNVTILAPIFAFLSGLFALYVLSRSVRSGKIWQFSYYCLFVAILSYLAG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: tma:TM0893

STRING: 243274.TM0893

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what role does it play in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (uppP), also known as bacA, is an integral membrane enzyme (EC 3.6.1.27) that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This reaction is critical in bacterial cell wall peptidoglycan synthesis pathway .

The undecaprenyl phosphate product serves as an essential lipid carrier for peptidoglycan precursors. In the bacterial cell wall synthesis pathway, UPP is released after the transfer of peptidoglycan precursors and must be dephosphorylated to UP for recycling back into the synthesis pathway . Without this recycling process, bacteria cannot effectively maintain cell wall integrity, making uppP a potential target for antibiotic development.

Thermotoga maritima uppP is a 237 amino acid integral membrane protein containing multiple transmembrane domains . As T. maritima is a hyperthermophilic bacterium, its uppP enzyme exhibits remarkable thermostability, making it particularly valuable for structural and biochemical studies.

What are the conserved motifs in uppP enzymes and how do they contribute to function?

The uppP enzyme family contains two highly conserved motifs that are critical for catalytic function:

  • The (E/Q)XXXE motif: Contains negatively charged glutamate residues that coordinate divalent metal ions (Mg²⁺ or Ca²⁺), which are absolute requirements for enzyme activity . In T. maritima uppP, these correspond to residues E17 and E21.

  • The PGXSRSXXT motif: Forms a putative structural P-loop that interacts with the phosphate groups of the substrate . The serine (S173), arginine (R174), and threonine (T178) residues in this motif form hydrogen bonds with the pyrophosphate moiety.

  • A conserved histidine residue (H30): Positioned spatially close to the pyrophosphate group and likely participates directly in the catalytic mechanism as a general acid/base .

Topological studies suggest that both motifs are localized near the aqueous interface of the membrane and face the periplasm, indicating that the enzyme functions on the outer side of the plasma membrane . Mutagenesis studies have shown that mutations in these conserved residues (E17A/E21A, H30A, S173A, R174A, and T178A) completely abolish enzyme activity, confirming their essential role in catalysis .

What expression systems yield optimal results for recombinant T. maritima uppP production?

For effective recombinant expression of T. maritima uppP, E. coli is the most commonly used host system. The expression has been successfully achieved using an N-terminal His tag in E. coli as noted in commercial product information .

The following parameters have proven effective for expression:

  • Expression vector: pET series vectors under the control of the T7 promoter

  • E. coli strain: BL21(DE3) or specialized strains like C41(DE3)/C43(DE3) designed for membrane protein expression

  • Induction conditions: Reduced temperatures (16-20°C) and lower IPTG concentrations (0.1-0.5 mM) to allow proper folding

  • Media supplements: Addition of glycerol (0.5-1%) and specific ions (Mg²⁺, Ca²⁺)

The thermostability of T. maritima proteins provides advantages during purification, as heat treatment steps (65-70°C) can be employed to remove host cell proteins while retaining uppP activity. Commercial products typically provide the recombinant protein in a storage buffer containing Tris-based buffer with 50% glycerol or 6% trehalose for stabilization .

How does the membrane topology of uppP influence its enzymatic function?

The membrane topology of uppP is critical for its function as it must access its substrate, undecaprenyl pyrophosphate (UPP), which is embedded in the bacterial membrane. Based on topological predictions and experimental evidence:

This topology is crucial for understanding substrate accessibility and for the rational design of inhibitors that must be able to access the active site either through the membrane or from the periplasmic space.

What is the proposed catalytic mechanism for T. maritima uppP?

The catalytic mechanism of uppP absolutely requires divalent metal ions, either Mg²⁺ or Ca²⁺, for activity. Based on biochemical studies and structural modeling, the following mechanism has been proposed:

  • Metal coordination: The divalent metal ion is coordinated by the conserved glutamate residues in the (E/Q)XXXE motif (E17 and E21 in T. maritima uppP) .

  • Substrate activation: The metal ion polarizes the phosphorus-oxygen bond in the pyrophosphate group, making the phosphorus more electrophilic while simultaneously activating a water molecule to serve as a nucleophile .

  • Catalytic steps:

    • The metal-activated water molecule attacks the β-phosphorus atom of the pyrophosphate

    • The conserved histidine (H30) may act as a general base to abstract a proton from the attacking water

    • The PGXSRSXXT motif stabilizes the developing negative charges during the transition state

  • Product release: The products (undecaprenyl phosphate and inorganic phosphate) are released, and the metal ion is retained in the active site for the next catalytic cycle .

This metal-dependent mechanism is supported by evidence that chelating agents like EDTA completely inhibit enzyme activity, which can be restored upon addition of excess Mg²⁺ or Ca²⁺, and by the fact that mutations in the metal-coordinating glutamates abolish activity .

How do mutations in conserved motifs affect T. maritima uppP activity?

Systematic mutagenesis studies provide insights into how specific residues within the conserved motifs contribute to catalysis:

MutationResidual Activity (%)Proposed Function
E17A<1Metal coordination, substrate binding
E21A<1Metal coordination
H30A<1Catalytic acid/base
S173A<1Substrate recognition and positioning
R174A<1Interaction with pyrophosphate moiety
T178A<1Stabilization of transition state

The (E/Q)XXXE motif (E17 and E21 in T. maritima) is involved in coordinating the essential divalent metal ions (Mg²⁺ or Ca²⁺) . Mutations of these glutamate residues to alanine completely abolish enzyme activity by eliminating the metal binding site .

The PGXSRSXXT motif forms a structural element similar to a P-loop found in many phosphate-binding proteins . Within this motif, serine (S173) forms hydrogen bonds with the phosphate oxygens, arginine (R174) provides positive charge for interaction with negatively charged phosphate groups, and threonine (T178) contributes to the positioning of the substrate .

The conserved histidine (H30) likely serves as a catalytic acid/base, possibly donating a proton to the leaving group during the reaction . The H30A mutation renders the enzyme inactive, confirming its essential role .

What purification methods yield the highest purity and activity for recombinant T. maritima uppP?

Purification of recombinant T. maritima uppP requires specialized methods optimized for membrane proteins while preserving the unique properties of this thermophilic enzyme:

  • Affinity chromatography:

    • For His-tagged uppP, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is the primary method

    • Buffer conditions typically include 50 mM Tris-HCl (pH 7.5-8.0), 300-500 mM NaCl, with appropriate detergent

    • Step-wise imidazole gradient for washing and elution improves purity

  • Detergent selection:

    • Critical for extracting uppP from membranes while maintaining its native conformation

    • n-Dodecyl-β-D-maltoside (DDM) and n-octyl-β-D-glucoside (OG) are frequently effective

    • Detergent concentration should be maintained above its critical micelle concentration (CMC)

  • Heat treatment:

    • Exploiting T. maritima uppP thermostability by incubating at 65-70°C for 10-15 minutes

    • This step eliminates most E. coli host proteins while retaining uppP activity

  • Size exclusion chromatography (SEC):

    • Secondary purification step after IMAC

    • Separates monomeric uppP from aggregates and remaining contaminants

  • Storage conditions:

    • Commercial preparations often use Tris-based buffer with 50% glycerol or 6% trehalose

    • Storage at -20°C/-80°C in aliquots to avoid freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

For highest activity, ensure inclusion of 1-5 mM MgCl₂ or CaCl₂ in all buffers used for activity assays, as these divalent cations are essential cofactors for uppP function .

What are the optimal assay conditions for measuring T. maritima uppP activity in vitro?

Establishing optimal assay conditions is critical for accurately measuring the enzymatic activity of T. maritima uppP in vitro:

  • Assay temperature:

    • Optimal temperature range: 60-80°C (reflecting T. maritima's thermophilic nature)

    • For comparative studies with mesophilic homologs: 37-45°C can be used

  • Buffer composition:

    • Buffer: 20 mM Tris-HCl (pH 7.5-8.0) or 20 mM HEPES (pH 7.5)

    • Salt: 150 mM NaCl to maintain ionic strength

    • Essential cofactor: 1-5 mM MgCl₂ or CaCl₂

    • Detergent: 0.01-0.05% (v/v) Triton X-100, DDM, or CHAPS (above CMC)

  • Substrate preparation:

    • Natural substrate (undecaprenyl pyrophosphate) or synthetic analogs with shorter prenyl chains

    • Substrate concentration: 25-50 μM for standard assays

    • For kinetic parameters: vary concentration from 1-100 μM

  • Detection methods:
    a) Continuous spectrophotometric assay:

    • Coupling phosphate release to MESG (2-amino-6-mercapto-7-methylpurine ribonucleoside) and purine nucleoside phosphorylase

    • Measure absorbance at 360 nm

    • Reaction mixtures containing 400 μM MESG, 350 μM IPP, 35 μM FPP, 20 mM Tris-HCl buffer (pH 7.5), 0.01% v/v Triton X-100, and 1 mM MgCl₂

    b) Radiometric assay:

    • Using [³H]-labeled substrate

    • Parameters: 2.5 μM FPP, 25 μM [³H]IPP, and 0.01% v/v Triton X-100

When reporting activity, standardize to specific activity (μmol/min/mg protein) and provide detailed methods to ensure reproducibility across laboratories.

How can site-directed mutagenesis be used to investigate structure-function relationships in T. maritima uppP?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in T. maritima uppP, providing insights into catalytic mechanisms and structural features:

  • Experimental workflow:
    a) Mutagenesis design:

    • PCR-based methods using overlapping primers containing the desired mutation

    • QuikChange protocol or Gibson Assembly for introducing mutations

    b) Expression screening:

    • Small-scale expression trials of multiple mutants simultaneously

    • Western blot analysis to confirm expression levels

    c) Purification and characterization:

    • Parallel purification of wild-type and mutant proteins using identical conditions

    • Activity assays under standard conditions to quantify effects of mutations

  • Strategic mutation targets:

    RegionResiduesPurpose of Mutation
    (E/Q)XXXE motifE17, E21Metal coordination, catalysis
    PGXSRSXXT motifS173, R174, T178Substrate binding, transition state stabilization
    Conserved HisH30Catalytic acid/base function
  • Types of mutations to consider:
    a) Conservative substitutions:

    • E→D to maintain charge but alter geometry

    • R→K to maintain positive charge with different hydrogen bonding pattern

    b) Non-conservative substitutions:

    • Charge elimination (E→A, R→A) to assess electrostatic contributions

    • Charge reversal (E→R, R→E) to test ionic interactions

  • Advanced mutagenesis approaches:
    a) Double/triple mutants:

    • Test cooperative effects between residues

    • Create compensatory mutations to rescue activity

    b) Domain swapping:

    • Exchange regions between T. maritima and mesophilic homologs

    • Identify domains responsible for thermostability

This systematic mutagenesis approach can provide detailed insights into the relationship between sequence, structure, and function in T. maritima uppP, while also identifying key features responsible for its thermostability and catalytic mechanism .

What structural features contribute to the thermostability of T. maritima uppP?

The thermostability of T. maritima uppP can be attributed to several structural features that differentiate it from mesophilic homologs. These adaptations allow the enzyme to function optimally at the high temperatures (around 80°C) preferred by T. maritima:

These structural adaptations collectively contribute to the enzyme's ability to maintain its native conformation and catalytic activity at temperatures that would denature mesophilic proteins, making T. maritima uppP valuable for both fundamental research on protein thermostability and biotechnological applications requiring thermal resistance.

How can molecular dynamics simulations be used to study substrate binding in T. maritima uppP?

Molecular dynamics (MD) simulations provide powerful tools for investigating substrate binding and catalytic mechanisms of T. maritima uppP at atomic resolution:

  • System preparation:
    a) Structural model generation:

    • Homology modeling based on related structures if no crystal structure is available

    • Refinement using multiple templates and secondary structure predictions

    b) Membrane embedding:

    • Place the protein model in a lipid bilayer using tools like CHARMM-GUI

    • Create a simulation box with explicit water molecules and physiological ion concentration

  • Simulation protocols:
    a) System equilibration:

    • Energy minimization to remove steric clashes

    • Gradual heating to simulation temperature (310K for standard simulations, 353K for thermophilic conditions)

    b) Production simulations:

    • Multiple independent simulations of 100-500 ns each

    • Enhanced sampling methods for substrate binding events

  • Enhanced sampling techniques:
    a) Steered molecular dynamics (SMD):

    • Guide the substrate into and out of the binding site along predefined paths

    • Identify key interaction residues during substrate entry/exit

    b) Metadynamics:

    • Add history-dependent biasing potentials to overcome energy barriers

    • Define collective variables based on distances between substrate and key residues (E17, E21, H30, S173, R174)

  • Analysis approaches:
    a) Binding pose characterization:

    • Hydrogen bond analysis between substrate and protein

    • Monitoring of metal ion coordination geometry

    • Calculation of interaction energies with specific residues

    b) Water and ion dynamics:

    • Tracking water molecules in the active site

    • Identifying water molecules involved in catalysis

    • Analyzing Mg²⁺/Ca²⁺ coordination and residence times

By combining these MD simulation approaches, researchers can gain detailed insights into the substrate binding process, structural dynamics, and catalytic mechanism of T. maritima uppP that would be difficult to obtain through experimental methods alone.

How can T. maritima uppP be used as a model system for developing antibacterial inhibitors?

T. maritima uppP serves as an excellent model system for developing inhibitors against bacterial cell wall synthesis for several reasons:

  • Structural advantages:

    • The thermostability of T. maritima uppP makes it more amenable to structural studies

    • More stable protein-inhibitor complexes allow for detailed binding studies

    • Conserved active site across bacterial species ensures transferability of findings to pathogenic bacteria

  • Screening workflows:

    • High-throughput inhibitor screening can be performed at elevated temperatures, reducing false positives

    • Initial biochemical assays with purified T. maritima uppP

    • Counter-screening against human phosphatases to ensure selectivity

    • Activity confirmation against uppP from pathogenic species

  • Structure-activity relationship (SAR) studies:

    • The well-defined active site of T. maritima uppP, with characterized (E/Q)XXXE and PGXSRSXXT motifs, provides clear targets for rational inhibitor design

    • Key interactions to target include metal-coordinating groups that compete with the essential Mg²⁺/Ca²⁺

  • Potential for combination therapy:

    • Inhibitors of uppP could potentiate the action of existing antibiotics targeting cell wall synthesis

    • Combined therapy approaches might restore sensitivity to drugs where resistance has emerged (e.g., methicillin, vancomycin)

    • Recent studies have identified compounds active against MRSA and VRE that target this pathway

Compound ClassActive Site TargetIC50 Range (μM)Activity Against Resistant Strains
RhodaninesMetal binding site0.5-5Active against MRSA, VRE
DihydroxyphenylsSubstrate binding pocket1-10Moderate activity
PyrimidinetrionesPGXSRSXXT motif2-20Activity against B. anthracis

The essential nature of uppP in bacterial cell wall synthesis makes it difficult for bacteria to develop resistance without significant fitness costs, highlighting its potential as an antibacterial target .

What approaches can be used to crystallize membrane-bound T. maritima uppP for structural studies?

Crystallizing membrane proteins like T. maritima uppP is challenging but essential for understanding its structure and function. Several specialized approaches can improve the chances of successful crystallization:

  • Detergent screening and optimization:

    • Test multiple detergent classes: maltoside series (DDM, DM), glucoside series (OG), CHAPS

    • Evaluate protein stability in each detergent using thermal shift assays

    • Consider detergent mixtures and addition of lipids as stabilizers

  • Protein engineering strategies:
    a) Construct optimization:

    • Remove flexible termini

    • Create minimal functional constructs

    b) Fusion protein approaches:

    • T4 lysozyme fusion in a loop region

    • These rigid, soluble domains provide additional crystal contacts

  • Crystallization techniques:
    a) Lipidic mesophases:

    • Lipidic cubic phase (LCP) crystallization

    • More native-like environment for membrane proteins

    • Often yields better-diffracting crystals

    b) Vapor diffusion with modifications:

    • Sitting or hanging drop with detergent-solubilized protein

    • Addition of small amphiphiles

    • Inclusion of specific lipids from T. maritima

  • Crystallization additives for thermostable proteins:
    a) Temperature considerations:

    • Set up parallel trials at different temperatures (4°C, 20°C, 37°C)

    • Exploit thermostability by performing some steps at elevated temperatures

    b) Specific additives:

    • Substrate analogs or inhibitors to stabilize one conformation

    • Divalent cations (Mg²⁺, Ca²⁺) required for activity

    • Antibody fragments (Fab, nanobodies) to increase polar surface area

The thermostable nature of T. maritima uppP provides advantages for crystallization, as the protein is less likely to denature during purification and crystallization attempts.

What are effective strategies for reconstituting purified T. maritima uppP into liposomes?

Reconstituting purified T. maritima uppP into liposomes creates a more native-like membrane environment for functional studies, allowing investigation of its activity, orientation, and substrate accessibility:

  • Liposome preparation:
    a) Lipid composition optimization:

    • E. coli polar lipid extract (70% PE, 20% PG, 10% cardiolipin) as a bacterial-mimetic system

    • Consider archaeal-like lipids to better mimic T. maritima's native environment

    • Test lipids with varying acyl chain lengths and degrees of saturation

    b) Preparation methods:

    • Thin film hydration followed by freeze-thaw cycles and extrusion

    • Extrusion through polycarbonate membranes (100-400 nm) for size control

  • Protein incorporation techniques:

    MethodDescriptionBest For
    Direct incorporationAdd detergent-solubilized protein to preformed liposomesSimple protocol, good for screening
    Detergent removalMix lipids, protein, and detergent, then remove detergentBetter control of protein orientation

    Detergent removal strategies include Bio-Beads SM-2 adsorption (efficient for DDM, OG), dialysis, or gel filtration.

  • Thermostability considerations:
    a) Temperature control:

    • Perform reconstitution at moderate temperatures (25-37°C)

    • Consider stepwise temperature increases to exploit T. maritima uppP thermostability

    b) Buffer optimization:

    • Higher ionic strength buffers (150-300 mM NaCl)

    • Addition of glycerol (5-10%) for added stability

    • Inclusion of divalent cations (1-5 mM Mg²⁺ or Ca²⁺)

  • Functional assays for reconstituted uppP:
    a) Activity measurements:

    • Radiometric assays with labeled substrate

    • Colorimetric detection of released phosphate

    • Direct quantification of lipid products by TLC or HPLC

    b) Substrate accessibility studies:

    • Compare activity with substrate added to the external vs. internal compartment

    • Use of substrate analogues with varying lipophilicity

    • Competition experiments with inhibitors

These reconstitution strategies provide a powerful approach for studying T. maritima uppP in a membrane environment that more closely resembles its native state, enabling detailed investigation of its function, substrate specificity, and inhibitor interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.