Recombinant Thermotoga maritima UPF0092 membrane protein TM_0859 (TM_0859)

What is Thermotoga maritima UPF0092 membrane protein TM_0859?

TM_0859 is an integral membrane protein found in the hyperthermophilic bacterium Thermotoga maritima strain ATCC 43589/MSB8. It belongs to the UPF0092 protein family and consists of 116 amino acids with the sequence: MPEIIYAAAPGASNGTTTATGGGWGSLLF(M)LIFFIAIFYFMIILPQRRREKQFQQMISQMKRGDTVVTIGGIVGKVIDIKKDTVKIKTANSTELEITKRAISTVIKERSQENQEG . The protein is identified in UniProt database with accession number Q9WZW3 and is encoded by the gene locus TM_0859 .

What are the optimal storage conditions for recombinant TM_0859?

For recombinant TM_0859, the recommended storage conditions are:

• Short-term (up to one week): Store working aliquots at 4°C

• Medium-term (up to 6 months): Store at -20°C in liquid form

• Long-term (up to 12 months): Store at -20°C or -80°C in lyophilized form

• Buffer composition: Typically supplied in Tris-based buffer with 50% glycerol

• Important precaution: Avoid repeated freeze-thaw cycles as this may compromise protein integrity

What expression systems are commonly used for producing recombinant TM_0859?

E. coli is the predominant expression system for recombinant TM_0859 production due to:

• Compatibility with thermophilic proteins

• High yield potential through optimized protocols

• Established genetic tools for manipulation

• Relatively low cost compared to alternative expression systems

• Ability to modify growth conditions to improve soluble protein expression

The recombinant protein can be produced with >85% purity as confirmed by SDS-PAGE analysis, typically using affinity tags to facilitate purification, though the specific tag type may vary depending on the production process .

How can I optimize the expression conditions for soluble recombinant TM_0859?

Optimizing TM_0859 expression requires a multifactorial approach:

• Apply statistical experimental design methodology (fractional factorial design) to evaluate multiple variables simultaneously:

  • Induction conditions (absorbance at induction, IPTG concentration)

  • Expression temperature

  • Media composition (yeast extract, tryptone, glucose concentrations)

  • Duration of expression

• Focus on variables with statistically significant effects based on this example table from similar protein expression studies:

• Crucial consideration: Harvest cells prior to glucose exhaustion, just before the diauxic shift, as this timing is critical for optimal membrane protein yields .

What detergents are most effective for solubilizing TM_0859 for structural studies?

Detergent selection is critical for maintaining native-like membrane protein structure. Based on studies of T. maritima membrane proteins:

• Detergents with longer alkyl chains typically provide better solubilization efficiency but may create larger micelles that affect structural determination techniques.

• Recommended screening approach:

  • Test multiple detergents: FC-10, FC-12, DM, DoDM, LDAO, LPPG, and CHAPS

  • Evaluate protein-detergent complex (PDC) stability using techniques like SAXS and NMR

  • Assess homogeneity, oligomeric state, and radius of gyration (Rg)

• For TM_0859 specifically, optimal detergent depends on the intended analytical method:

  • For NMR studies: FC-12 has shown favorable properties with similar T. maritima membrane proteins

  • For crystallography: LDAO or DM may be more suitable due to smaller micelle size

  • For functional studies: Milder detergents like DDM may better preserve activity

Note that the Rg and forward scattering intensity (I(0)) values provide critical information about the PDC and can help determine if the selected detergent is appropriate for structural studies .

How can Small Angle X-ray Scattering (SAXS) be used to characterize TM_0859 in detergent micelles?

SAXS provides valuable structural information about TM_0859 in solution:

• Novel application method not requiring density matching:

  • Collect scattering profiles for buffer, detergent micelle, and protein-detergent complex

  • Calculate Rg using two complementary approaches: I(complex-buffer) and I(complex-micelle)

  • The true Rg value typically falls between these two estimates

• Data analysis approach for TM_0859:

  • Evaluate Guinier plots to confirm sample homogeneity

  • Calculate excess electron density to estimate oligomeric state

  • Compare Rg values across different detergents to identify optimal conditions

• Experimental considerations:

  • Sample concentration must be optimized to minimize interparticle interference

  • Strong scattering detergents (DM, DoDM, CHAPS) can reduce accuracy (errors up to ±10 Å)

  • FC-12 typically provides more reliable measurements for T. maritima membrane proteins

What NMR approaches are most suitable for structural characterization of TM_0859?

For NMR studies of TM_0859, consider the following approaches:

• Sample preparation considerations:

  • Express in minimal media with 15N and 13C labeling

  • Use deuterated detergents to reduce micelle signal interference

  • Maintain protein concentration between 0.3-1.0 mM

• Recommended NMR experiments:

  • 1H-15N HSQC/TROSY to assess folding and stability

  • 3D experiments (HNCA, HNCACB, HNCO) for backbone assignment

  • NOE-based distance measurements for structure calculation

• Special considerations for TM_0859:

  • Its relatively small size (~12.6 kDa) makes it amenable to standard solution NMR

  • The contribution of the detergent micelle to molecular tumbling must be considered

  • Check for conformational exchange which might complicate spectrum interpretation

  • Monitor oligomerization state which can affect spectral quality

How does TM_0859 compare structurally with other membrane proteins from Thermotoga maritima?

Based on structural genomics studies of T. maritima membrane proteins:

• TM_0859 belongs to the UPF0092 family, one of approximately 446 putative α-helical membrane proteins in T. maritima .

• Comparative structural features:

  • Unlike transcriptional regulators like TM0439, TM_0859 lacks an FCD domain and metal-binding sites

  • Contains a hydrophobic core typical of integral membrane proteins

  • Shows sequence/structural conservation across thermophilic bacteria

  • Predicted to have multiple transmembrane helices based on hydrophobicity analysis

• Evolutionary significance:

  • TM_0859 represents one of the smaller membrane proteins in T. maritima (<16 kDa)

  • Its conservation suggests functional importance despite being classified as a protein of unknown function

  • May play a role in adapting to high-temperature environments, a characteristic feature of T. maritima

What approaches can resolve the oligomeric state of TM_0859 in membranes?

Determining the oligomeric state of TM_0859 requires multiple complementary techniques:

• Cross-linking studies:

  • Chemical cross-linkers with varying spacer lengths can capture native oligomeric interactions

  • Results must be interpreted carefully as detergent environments may not perfectly mimic native membranes

• Analytical ultracentrifugation:

  • Sedimentation velocity experiments can distinguish between monomeric and oligomeric forms

  • Requires correction for detergent contribution to buoyant mass

• SAXS analysis to determine molecular weight:

  • Forward scattering intensity (I(0)) provides model-free measurement of total excess electron density

  • Constraints can be applied to estimate the contributions of protein and detergent

  • Oligomeric state can be estimated once these constraints are satisfied

• Blue native PAGE:

  • Provides separation of protein complexes in their native state

  • Can be combined with western blotting for specific detection

What strategies can improve membrane localization of recombinant TM_0859?

Ensuring proper membrane localization during recombinant expression:

• Critical considerations:

  • Properly folded membrane proteins localize to the membrane fraction

  • Unfolded proteins typically accumulate in inclusion bodies (insoluble fraction)

  • Separate these fractions during purification to avoid refolding complications

• Enhanced expression strategy:

  • Use specialized E. coli strains like C41(DE3) designed for membrane protein expression

  • Reduce expression rate by lowering temperature (20-25°C) and inducer concentration

  • Add glycerol (5-10%) to culture media to stabilize membranes

  • Include mild solubilizing agents in lysis buffer to improve extraction efficiency

• Verification methods:

  • Perform fractionation to confirm membrane localization versus inclusion body formation

  • Use fluorescent fusion tags to visualize cellular localization

  • Consider experimental validation through membrane fraction isolation, as approximately 18% of T. maritima membrane proteins have been shown to overexpress to the membrane

How might the function of TM_0859 relate to Thermotoga maritima's unique physiological characteristics?

While the specific function of TM_0859 remains uncharacterized:

• Contextual analysis suggests potential roles:

  • T. maritima is an extremophile capable of surviving at temperatures up to 90°C

  • Membrane proteins play crucial roles in maintaining membrane integrity at extreme temperatures

  • TM_0859's conservation across thermophilic bacteria suggests importance in thermoadaptation

• Genomic context analysis:

  • TM_0859 is not part of any known operon related to sugar metabolism, unlike many characterized genes in T. maritima

  • Not regulated by any of the 18 local transcription factor regulons identified in carbohydrate utilization networks

  • May be involved in more fundamental cellular processes than substrate-specific transport

• Phylogenetic significance:

  • T. maritima is considered an ancient organism based on its deep lineage

  • Studies of its membrane proteins provide insights into early evolution of life

  • TM_0859 may represent a conserved ancestral membrane protein with fundamental cellular functions

Why might recombinant TM_0859 show low functional activity despite high expression levels?

When expression levels are high but functional activity is low, consider these factors:

• Protein folding issues:

  • Hyperthermophilic proteins may not fold properly at standard expression temperatures

  • Try expression at higher temperatures (37-42°C) to improve folding

  • Consider co-expression with chaperones specific for membrane proteins

• Post-translational modifications:

  • Verify if native TM_0859 undergoes post-translational modifications absent in recombinant systems

  • E. coli may lack necessary machinery for modification/processing

• Detergent-related inactivation:

  • Some detergents can strip essential lipids or disrupt critical protein-lipid interactions

  • Try milder detergents or add specific lipids back during purification

  • Consider reconstitution into nanodiscs or liposomes for functional studies

• Multiprotein complex requirements:

  • Many membrane proteins function within complexes

  • Absence of partner proteins may result in properly folded but inactive protein

How can I resolve challenges in determining the structure of TM_0859 using NMR spectroscopy?

NMR structural studies of membrane proteins like TM_0859 present unique challenges:

• Signal quality issues:

  • Screen multiple detergents as they significantly impact spectral quality

  • Consider protein deuteration to improve relaxation properties

  • Optimize temperature (potentially using higher temperatures appropriate for thermophilic proteins)

  • Try different buffer conditions to minimize exchange broadening

• Assignment difficulties:

  • Use selective labeling strategies to reduce spectral complexity

  • Consider segmental labeling if specific regions prove problematic

  • Employ paramagnetic probes to obtain long-range distance constraints

• Structure calculation challenges:

  • Combine NMR data with complementary techniques (SAXS, EPR, cryo-EM)

  • Use residual dipolar couplings to improve orientation of helical segments

  • Incorporate knowledge from homology modeling if structural homologs exist

• Validation strategies:

  • Use mutagenesis to confirm key structural features

  • Verify structure in different detergent environments to ensure consistency

  • Compare with biochemical/biophysical data to ensure biological relevance