Recombinant Thermotoga maritima UPF0118 membrane protein TM_1349 (TM_1349)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TM_1349; Putative transport protein TM_1349
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Target Names
TM_1349
Target Protein Sequence
MKEFRKILEDKAFFFTTLYILISFLVFKIFPDVFAVIVLMVFFTLLLDPVIRFLEKLKFG KYFSRVAALLLFFFVMVYSLYMIIPPVFNEFGSFIEFMTKVFESKIWKDYIKSPELMPVF DKIMNFLEPKLTDFLNYVFSLVTTNFVSVTTIIVFTLFGLGYTVFYIREIASFFVLIYPK SVRAEAREFFRDVYASMGRYIRVIFINAVIIGLSYWIVFEAFNLKYSAIISLWAFVTNFI PIVGVVLEYIPVLLFSLTLGVKGVLLIALFAILIHAVAFVVFIQLMKGLEKLNPVYIILS ILFFGKLFGLFGSFVGVPLALFFKVFWRKFLRPLFEAG
Uniprot No.

Target Background

Database Links

KEGG: tma:TM1349

STRING: 243274.TM1349

Protein Families
Autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thermotoga maritima and why is it significant for protein research?

Thermotoga maritima is a hyperthermophilic bacterium originally isolated from anaerobic marine mud in Vulcano Island, Italy . The organism is cultivated under anaerobic conditions at 80°C in Medium 343 , making it an extremophile of significant interest to researchers studying protein thermostability.

The bacterium's importance stems from several key factors:

  • Its proteins, including TM_1349, demonstrate exceptional thermal stability

  • It represents one of the earliest diverging bacterial lineages

  • The complete genome sequencing of T. maritima has revealed numerous proteins with potential biotechnological applications

  • Its proteins serve as models for understanding evolutionary adaptations to extreme environments

For membrane protein researchers specifically, T. maritima offers valuable insights into how integral membrane structures maintain functionality at temperatures that would denature most mesophilic proteins.

What is the UPF0118 membrane protein TM_1349 and what is its functional significance?

TM_1349 is classified as part of the UPF0118 (Uncharacterized Protein Family 0118) and is also annotated as a "putative transport protein" . The protein comprises 338 amino acids and contains multiple predicted transmembrane domains based on sequence analysis .

While the precise physiological role remains under investigation (hence the UPF designation), several characteristics suggest potential functions:

  • The membrane localization indicates possible roles in:

    • Substrate transport across membranes

    • Signal transduction

    • Maintaining membrane integrity at elevated temperatures

Sequence analysis reveals multiple hydrophobic regions consistent with transmembrane helices, supporting its classification as an integral membrane protein . Further experimental characterization is necessary to elucidate its precise biological function in T. maritima.

How is recombinant TM_1349 protein expressed and purified for research applications?

The standard protocol for producing research-grade TM_1349 involves heterologous expression in E. coli followed by multi-step purification:

Production ParameterSpecificationReference
Expression SystemE. coli
Protein ConstructionFull-length (amino acids 1-338) with N-terminal His-tag
Purification MethodLikely affinity chromatography utilizing His-tag
Final PurityGreater than 90% as determined by SDS-PAGE
Final FormLyophilized powder

This expression system allows for sufficient protein yields while the N-terminal His-tag facilitates efficient purification without significantly disrupting the native protein structure. The high purity level (>90%) ensures reliability in subsequent experiments, particularly for structural studies and functional assays .

What are the optimal storage and handling conditions for recombinant TM_1349?

Based on established protocols for thermostable membrane proteins, TM_1349 requires specific storage and handling conditions to maintain structural integrity and functional activity:

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Prepare multiple small aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

  • Storage buffer contains Tris/PBS with 6% trehalose at pH 8.0

Reconstitution Protocol:

  • Centrifuge vial briefly before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

The addition of trehalose and glycerol serves as cryoprotectants, helping maintain the protein's native conformation during freeze-thaw cycles and preventing aggregation.

How does the His-tag affect structural and functional studies of TM_1349?

The addition of an N-terminal His-tag to TM_1349 has both methodological benefits and potential research implications:

Advantages for Research Applications:

  • Enables efficient purification through metal affinity chromatography

  • Provides a consistent epitope for antibody detection

  • Allows for quantification through standardized assays

Potential Impacts on Structure-Function Studies:

  • May introduce conformational constraints at the N-terminus

  • Could potentially affect protein-protein or protein-lipid interactions

  • Might influence crystallization properties for structural determination

  • Could alter membrane insertion dynamics in reconstitution experiments

For membrane proteins like TM_1349, tag placement requires careful consideration as it may affect transmembrane topology. Researchers conducting functional studies should consider control experiments with tag-cleaved protein to confirm that observed activities are not artifacts of the His-tag presence.

What experimental approaches are most effective for functional characterization of TM_1349?

Given the challenges associated with membrane protein research, a multi-faceted approach is recommended for functional characterization of TM_1349:

Structural Characterization Methods:

  • X-ray crystallography (with appropriate detergent screening or lipidic cubic phase methods)

  • Cryo-electron microscopy for structure determination without crystallization

  • NMR spectroscopy for dynamic studies of specific domains

Functional Analysis Techniques:

  • Liposome reconstitution for transport assays if a transporter function is suspected

  • Binding assays with potential substrates or interaction partners

  • Spectroscopic methods to detect conformational changes upon substrate binding

  • Thermostability assays to determine melting temperature and stabilizing conditions

Expression Optimization Strategies:

  • Detergent screening for optimal solubilization while maintaining function

  • Expression in specialized systems (cell-free, yeast, or insect cells) if E. coli yields are insufficient

  • Use of nanodiscs or amphipols to provide a more native-like membrane environment

Each approach provides complementary information, with the collective data offering a more comprehensive understanding of TM_1349's biological role and mechanistic function.

How does TM_1349's thermostability compare to homologous proteins from mesophilic organisms?

Although specific comparative thermostability data for TM_1349 is not provided in the search results, general principles of protein thermostability in T. maritima suggest several important distinctions:

PropertyTM_1349 (Thermophilic)Mesophilic Homologs
Temperature StabilityFunctional at 80°C (T. maritima optimal growth temperature) Typically denatured above 40-50°C
Amino Acid CompositionEnriched in charged residues; reduced thermolabile residuesHigher content of Asn, Gln, and Cys
Structural AdaptationsMore extensive salt bridges and hydrophobic interactionsFewer electrostatic interactions
Membrane IntegrationAdapted for high-temperature membrane fluidityOptimized for mesophilic membrane properties

Experimental methods to quantify these differences would include:

  • Thermal shift assays comparing melting temperatures

  • Activity measurements across temperature gradients

  • Structural comparisons identifying specific stabilizing interactions

  • Reconstitution into liposomes of varying composition to assess membrane interaction differences

These thermostability adaptations make TM_1349 potentially valuable for biotechnological applications requiring robust membrane proteins.

What challenges exist in crystallizing membrane proteins like TM_1349, and how can they be addressed?

Crystallizing membrane proteins presents distinct challenges, particularly for thermophilic proteins like TM_1349:

Core Challenges:

  • Detergent micelles create nonpolar surfaces limiting crystal contact formation

  • Conformational heterogeneity reduces crystallization propensity

  • Extracting proteins from native membrane environments can disrupt structure

  • Limited protein quantities often restrict extensive screening

Recommended Strategies:

  • Protein Engineering Approaches:

    • Surface entropy reduction to create favorable crystal contacts

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Antibody fragment co-crystallization to increase polar surface area

  • Lipid and Detergent Optimization:

    • Comprehensive detergent screening (starting with mild detergents)

    • Lipidic cubic phase crystallization to mimic native membrane environment

    • Bicelle or nanodisc approaches to maintain native-like lipid interactions

  • Crystallization Technique Refinements:

    • Sparse matrix screening with membrane protein-specific conditions

    • Microseeding to improve crystal quality

    • Controlled dehydration to improve diffraction quality

  • Alternative Structural Methods:

    • Single-particle cryo-electron microscopy (increasingly successful for membrane proteins)

    • Solid-state NMR for specific structural questions

    • Integrative structural biology combining multiple low-resolution techniques

The thermostability of TM_1349 may offer advantages during crystallization by reducing conformational flexibility, though the membrane nature remains challenging.

How can computational methods predict functional properties of TM_1349 when experimental data is limited?

Computational approaches offer valuable insights for poorly characterized proteins like TM_1349:

Sequence-Based Prediction Methods:

  • Multiple sequence alignments to identify conserved functional residues

  • Hidden Markov Models to detect remote homology relationships

  • Genomic context analysis (examining proximal genes potentially in shared pathways)

  • Phylogenetic profiling to identify co-evolving proteins

Structure-Based Approaches:

  • Homology modeling based on related membrane proteins

  • Threading and fold recognition to identify structural similarities

  • Molecular dynamics simulations to study conformational dynamics

  • Virtual screening and docking to predict potential binding partners

Integrated Computational Frameworks:

  • Machine learning approaches combining multiple features

  • Systems biology analyses incorporating transcriptomic and proteomic data

  • Network-based function prediction through protein-protein interaction networks

Validation Considerations:
As noted in the literature, computational predictions should be viewed as hypotheses requiring experimental validation, as cases exist where apparently confirmed computational predictions were later found to be erroneous . This necessitates a critical approach to computational results.

How can researchers validate computational predictions about TM_1349 function experimentally?

Validating computational predictions for membrane proteins like TM_1349 requires a systematic approach:

Direct Functional Assessment:

  • Transport assays using purified protein reconstituted in liposomes if a transporter function is predicted

  • Binding assays with predicted substrates or interaction partners

  • Enzymatic activity measurements if catalytic function is hypothesized

Structure-Based Validation:

  • Obtaining experimental structures to confirm predicted structural features

  • Site-directed mutagenesis of predicted functional residues

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamics of predicted functional regions

Cellular and Physiological Approaches:

  • Heterologous expression with functional complementation

  • Expression analysis under different growth conditions

  • Protein-protein interaction verification through pull-down assays or crosslinking

Critical Evaluation Framework:
The scientific literature highlights cases where computational predictions apparently validated by experiments were later found to be problematic . This underscores the importance of:

  • Implementing rigorous controls

  • Using multiple independent validation methods

  • Critically evaluating both positive and negative results

  • Considering alternative interpretations of experimental data

What insights can comparative analysis between TM_1349 and other T. maritima membrane proteins provide?

Comparative analysis within the T. maritima proteome offers valuable perspectives on TM_1349:

Evolutionary Context:

  • Assessment of TM_1349 conservation relative to other T. maritima membrane proteins

  • Identification of protein families unique to thermophiles versus universally conserved families

  • Detection of potential horizontal gene transfer events that may have introduced TM_1349

Structural Comparisons:

  • Analysis of thermostabilization strategies across different T. maritima membrane proteins

  • Comparison with the crystallized TM0439 GntR regulator to identify common structural adaptations

  • Identification of thermophile-specific structural motifs

Functional Networks:

  • Integration of TM_1349 into predicted functional networks within T. maritima

  • Analysis of co-expression patterns with other membrane proteins

  • Identification of potential interacting partners through genomic proximity or co-occurrence

Thermostability Mechanisms:

  • Comparative analysis of amino acid composition across T. maritima membrane proteins

  • Identification of conserved versus variable regions suggesting functional specialization

  • Assessment of membrane integration strategies at high temperatures

This comparative approach contextualizes TM_1349 within the broader cellular machinery of T. maritima, potentially revealing functional relationships not apparent from isolated study.

How might contradictory experimental results regarding TM_1349 function be reconciled through advanced experimental design?

When faced with contradictory results regarding membrane protein function:

Standardization of Experimental Conditions:

  • Ensure consistent protein preparation methods

  • Control environmental variables (pH, temperature, ionic strength)

  • Standardize detergent types and concentrations

  • Verify protein quality before each experimental series

Multi-Method Validation Approach:

  • Apply complementary techniques to address the same functional question

  • Utilize both in vitro reconstituted systems and in vivo approaches

  • Perform direct binding measurements alongside functional assays

Addressing Technical Artifacts:

  • Evaluate the impact of tags and fusion partners on function

  • Compare native lipid environment versus detergent solubilization

  • Assess oligomerization state and its impact on observed activities

Collaborative Verification:

  • Engage multiple laboratories with different methodological expertise

  • Implement blind testing protocols for critical experiments

  • Develop standardized positive and negative controls

The literature notes cases where computational predictions seemingly validated by experiment were later found problematic , emphasizing the need for rigorous experimental design and critical evaluation of results, especially for challenging targets like membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.