Recombinant Thermotoga petrophila Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Thermotoga petrophila Protein CrcB Homolog (crcB)

The Recombinant Thermotoga petrophila Protein CrcB homolog (crcB) is a bioengineered protein derived from the hyperthermophilic bacterium Thermotoga petrophila. This protein is a homolog of the crcB gene product, which functions as a fluoride-responsive transporter in microbial systems. The recombinant version is expressed in E. coli with an N-terminal His-tag (10xHis-tag) for purification and structural studies .

Table 1: Key Properties of Recombinant Thermotoga petrophila CrcB

PropertyDetails
UniProt IDA5IL48
Protein LengthFull-length (1-127 amino acids)
Source OrganismThermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995)
Expression SystemE. coli
TagN-terminal 10xHis-tag
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Purity>90% (SDS-PAGE validated)
Sequence (Partial)MIELDYLTIAFGGAIGAVLRYLVSRTINSLLPFSYIPLGTIIVNSVGSFFLSFLMFAAIEKVPLSKEAILFFGTGLLGAFTTFSTFTYETLSLIEESPARGVAYALVNLLFAFTCAYFGM ILGRGKV
Molecular WeightNot explicitly provided (calculated via sequence)

Functional Role in Fluoride Detoxification

The crcB protein is tightly linked to the fluoride riboswitch, an RNA regulatory element that senses fluoride ions (F⁻) and upregulates downstream genes to mitigate toxicity . Key findings include:

Mechanism of Action

  • Fluoride Binding: The riboswitch binds F⁻ via a Mg²⁺-coordinated pocket, rejecting other halides (Cl⁻, Br⁻, I⁻) .

  • Regulation of CrcB: In Thermotoga petrophila, elevated fluoride triggers riboswitch-mediated transcription of crcB, encoding a transmembrane protein proposed to export fluoride .

  • Structural Insights: X-ray crystallography and NMR studies reveal a pseudoknot structure stabilized by Mg²⁺ ions, positioning F⁻ in a negatively charged pocket .

Table 2: Experimental Contexts for Recombinant CrcB

ApplicationDetails
Structural StudiesCrystallography/NMR to study fluoride binding and riboswitch interactions .
Functional AssaysFluoride export activity in E. coli or archaeal systems .
Riboswitch EngineeringDevelopment of fluoride-inducible expression systems for hyperthermophiles .
Toxicity StudiesAssessing fluoride resistance in Thermococcus kodakarensis (via homologs) .

Research Findings and Implications

  1. Fluoride-Specific Transport: Deletion of crcB homologs (e.g., TK0514 in Thermococcus kodakarensis) causes hypersensitivity to fluoride, confirming its role as an export pump .

  2. Riboswitch Regulation: The fluoride riboswitch in Thermotoga petrophila shares conserved structural motifs (e.g., pseudoknots) with bacterial counterparts, enabling cross-species regulatory insights .

  3. Thermostable Systems: Recombinant CrcB homologs are exploited to study RNA-mediated regulation at high temperatures, expanding tools for extremophile research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
crcB; Tpet_0903; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995)
Target Names
crcB
Target Protein Sequence
MIELDYLTIAFGGAIGAVLRYLVSRTINSLLPFSYIPLGTIIVNSVGSFFLSFLMFAAIE KVPLSKEAILFFGTGLLGAFTTFSTFTYETLSLIEESPARGVAYALVNLLFAFTCAYFGM ILGRGKV
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Thermotoga petrophila and why is its CrcB homolog protein significant for research?

Thermotoga petrophila is a hyperthermophilic, anaerobic, non-spore-forming, rod-shaped bacterium first isolated from the Kubiki oil reservoir in Niigata, Japan . It belongs to one of the deepest branching bacteria phyla, Thermotogota, and is characterized by a distinctive sheath-like structure that balloons at both ends, known as a toga . The organism grows optimally at 80°C with a growth range of 47-88°C and pH range of 5.2-9.0 .

The CrcB homolog protein is particularly significant for several reasons:

  • It appears to be connected to fluoride sensing riboswitch mechanisms involved in resistance to F− cytotoxicity

  • As a protein derived from a hyperthermophilic organism, it possesses exceptional thermal stability properties

  • Understanding its structure and function provides insights into molecular adaptation to extreme environments

  • Its thermostable properties make it potentially valuable for biotechnological applications requiring high-temperature stability

The study of this protein offers unique opportunities to understand ion transport mechanisms in extremophiles and to develop novel applications leveraging its unusual stability characteristics.

How does the genomic context of T. petrophila inform our understanding of CrcB homolog function?

The genomic context of the CrcB homolog in Thermotoga petrophila provides valuable insights into its function and evolutionary significance:

  • Evolutionary Conservation: The CrcB homolog belongs to a highly conserved family of proteins found across diverse bacterial phyla, suggesting an important and ancient function. Despite the extensive recombination observed in Thermotoga genomes , the conservation of CrcB suggests strong selective pressure to maintain its function.

  • Riboswitch Association: In T. petrophila, the CrcB homolog appears to be associated with a fluoride-sensing riboswitch, suggesting its involvement in fluoride homeostasis mechanisms . This fluoride-responsive RNA structure likely regulates CrcB expression in response to environmental fluoride levels.

  • Genomic Organization: Comparative genomic analyses across Thermotoga species show that genes involved in similar functions often cluster together. The genomic neighborhood of the crcB gene may include other genes involved in membrane transport or stress response.

  • Phylogenetic Insights: T. petrophila belongs to a lineage that diverged from other Thermotoga species such as T. maritima and T. naphthophila . Despite sharing over 99% of its 16S rRNA genetic sequence with sister clades, recombination events have shaped genomic regions differently , potentially affecting the evolution of functional proteins like CrcB.

Understanding this genomic context helps researchers develop hypotheses about the protein's role in fluoride transport and resistance mechanisms, particularly under the extreme temperature conditions favored by T. petrophila.

What expression systems are most suitable for producing recombinant T. petrophila CrcB homolog protein?

For successful expression of the thermophilic T. petrophila CrcB homolog protein, researchers should consider the following expression systems and strategies:

  • E. coli-based Expression Systems:

    • Specialized strains (C41/C43) designed for membrane protein expression

    • Cold-shock expression systems that reduce protein aggregation

    • Codon-optimized constructs addressing the GC-rich content of Thermotoga genes

    • Fusion tags (SUMO, MBP, GST) to enhance solubility and facilitate purification

  • Thermophilic Expression Hosts:

    • Thermus thermophilus systems for expression at elevated temperatures

    • Geobacillus species that provide a more native-like membrane environment

    • Temperature-inducible promoter systems for controlled expression

  • Cell-free Protein Synthesis:

    • PURE system modified for thermostable protein production

    • Liposome supplementation for membrane protein integration

    • Direct incorporation into nanodiscs or lipid bilayers

  • Critical Parameters for Expression Optimization:

    ParameterRecommendationRationale
    Induction temperature18-25°C for mesophilic hosts; 50-65°C for thermophilic hostsBalances expression rate with proper folding
    Inducer concentrationLow (0.1-0.2 mM IPTG)Prevents formation of inclusion bodies
    Growth mediaRich media with osmotic stabilizersSupports membrane protein integration
    Harvest timingLate exponential phaseMaximizes yield while maintaining quality
    Cell lysisGentle methods (spheroplasting)Preserves membrane protein structure
  • Purification Considerations:

    • Detergent screening for optimal extraction (DDM, LDAO, CHAPS)

    • Heat treatment step (60-70°C) to leverage thermostability and remove host proteins

    • Size exclusion chromatography to separate oligomeric states

    • Stabilization with specific lipids during purification

These approaches address the dual challenges of expressing a thermophilic protein and ensuring proper membrane integration to obtain functional recombinant CrcB homolog protein.

How does the fluoride riboswitch interact with CrcB homolog expression in T. petrophila, and what experimental approaches best elucidate this relationship?

The fluoride sensing riboswitch in T. petrophila represents a sophisticated regulatory mechanism controlling CrcB homolog expression. Recent research has provided important insights into this system:

These mechanistic insights provide a foundation for understanding how T. petrophila has evolved sophisticated RNA-based regulation to maintain fluoride homeostasis in extreme environments.

What are the structural determinants of fluoride selectivity in the CrcB homolog, and how can these be experimentally verified?

Understanding the structural basis of fluoride selectivity in the CrcB homolog requires a multifaceted approach combining structural analysis with functional validation:

By integrating these approaches, researchers can develop a comprehensive model of how the CrcB homolog achieves fluoride selectivity in the challenging environment of a hyperthermophilic bacterium, potentially revealing novel principles of ion channel selectivity.

How can the thermostability of the CrcB homolog be characterized and potentially enhanced for biotechnological applications?

The exceptional thermostability of the T. petrophila CrcB homolog protein, derived from an organism with optimal growth at 80°C and survival up to 88°C , represents a valuable property for biotechnological applications. Characterizing and enhancing this thermostability requires systematic approaches:

  • Thermostability Characterization Methods:

    MethodMeasurementAdvantages
    Differential Scanning Calorimetry (DSC)Melting temperature (Tm)Direct measurement of thermal denaturation
    Circular Dichroism (CD)Secondary structure changes with temperatureMonitors structural integrity during heating
    Activity Assays at Varying TemperaturesFunctional half-life at elevated temperaturesCorrelates structure with function
    Intrinsic FluorescenceTertiary structure changesSensitive to subtle conformational alterations
    Limited ProteolysisResistance to proteolytic degradationAssesses compact folding and stability
  • Molecular Determinants of Thermostability:

    Analysis of the CrcB homolog sequence suggests several features likely contributing to its thermostability:

    • Higher content of charged amino acids forming salt bridges

    • Increased hydrophobic interactions in the protein core

    • Reduced number of thermolabile residues (Asn, Gln, Cys, Met)

    • Optimized surface charge distribution

    • Compact packing of secondary structure elements

  • Enhancement Strategies for Biotechnological Applications:

    • Rational Design Approaches:

      • Introduction of additional salt bridges at strategic positions

      • Proline substitutions in loop regions to reduce flexibility

      • Disulfide bond engineering for additional structural constraints

      • Surface charge optimization to enhance solubility at high temperatures

    • Directed Evolution Methods:

      • Error-prone PCR followed by high-temperature selection

      • DNA shuffling with other thermostable homologs

      • Consensus-based design incorporating features from multiple thermophilic proteins

      • Combinatorial library screening under thermal stress conditions

  • Formulation Approaches for Enhanced Stability:

    • Incorporation into thermostable lipid nanodiscs

    • Co-expression with specific chaperones

    • Addition of compatible solutes (trehalose, ectoine)

    • Development of protein-polymer conjugates with enhanced thermal properties

  • Potential Biotechnological Applications:

    • Fluoride biosensors for high-temperature industrial processes

    • Bioremediation systems for fluoride-contaminated hot springs or industrial wastewater

    • Model system for developing thermostable membrane protein expression platforms

    • Template for designing synthetic ion channels with enhanced stability

By systematically characterizing and enhancing the thermostability of the CrcB homolog, researchers can develop novel biotechnological tools capable of functioning under extreme conditions where conventional proteins would rapidly denature.

What role does the CrcB homolog play in the recombination-rich genome evolution of Thermotoga species?

The CrcB homolog exists within the fascinating context of Thermotoga's highly dynamic genome evolution, characterized by extensive recombination:

What are the optimal buffer conditions for maintaining the stability of purified recombinant CrcB homolog protein?

Optimizing buffer conditions is crucial for maintaining the stability and activity of the thermophilic membrane protein CrcB homolog from T. petrophila:

  • Core Buffer Components:

    ComponentRecommended RangeRationale
    Buffer BaseTris-based buffer, pH 7.0-8.0Matches physiological pH optimum of T. petrophila (pH 7.0)
    Glycerol50% for storagePrevents aggregation and provides cryoprotection
    Salt150-300 mM NaClMaintains ionic strength and protein solubility
    Reducing Agent1-5 mM DTT or β-mercaptoethanolPrevents oxidation of cysteine residues
    DetergentMild non-ionic (DDM, LMNG, 0.05-0.1%)Maintains membrane protein structure outside lipid bilayer
  • Storage Considerations:

    • Short-term storage: 4°C for up to one week

    • Extended storage: -20°C or -80°C

    • Avoid repeated freeze-thaw cycles, which can cause protein degradation

    • Aliquot protein solutions before freezing to minimize freeze-thaw damage

  • Stability Enhancers:

    • Addition of specific lipids (E. coli total lipid extract at 0.01-0.05 mg/ml)

    • Protein stabilizers (sucrose, trehalose at 5-10%)

    • For functional studies: consider fluoride addition (1-5 mM NaF) to stabilize bound state

    • Protease inhibitors for freshly purified protein

  • Temperature Considerations:

    Unlike most proteins, this thermophilic protein may exhibit enhanced stability at moderately elevated temperatures:

    • Consider room temperature handling for short procedures

    • Heat treatment (50-60°C) may actually enhance purity by precipitating contaminating proteins

    • Buffer components must remain stable at intended handling temperatures

  • Special Considerations for Specific Applications:

    ApplicationBuffer Modification
    CrystallizationReduce glycerol to <10%, remove reducing agents
    Functional assaysInclude potential cofactors (Mg2+, 1-5 mM)
    Reconstitution into liposomesDetergent that can be easily removed (e.g., octyl glucoside)
    Biophysical characterizationMinimize buffer components that interfere with measurements

These carefully optimized conditions will help maintain the structural integrity and functional properties of the CrcB homolog protein throughout purification and subsequent experimental procedures.

What experimental approaches are most effective for studying the fluoride transport mechanism of the CrcB homolog protein?

Investigating the fluoride transport mechanism of the CrcB homolog requires specialized techniques suitable for a thermophilic membrane protein:

  • Reconstitution Systems for Transport Studies:

    SystemMethodologyAdvantages
    ProteoliposomesReconstitution in defined lipid vesiclesComplete control over lipid composition and protein orientation
    Planar lipid bilayersElectrical measurements across artificial membranesDirect electrophysiological measurements
    NanodiscsProtein incorporation into disc-shaped lipid bilayersStable, monodisperse membrane mimetic system
    Cell-based assaysExpression in fluoride-sensitive bacterial strainsPhysiological context for transport
  • Fluoride Detection Methods:

    • Fluoride-Selective Electrodes: Direct measurement of fluoride concentration changes

    • Fluoride-Sensitive Fluorescent Probes: Real-time monitoring of transport

    • Radioactive 18F Tracers: Highly sensitive detection of fluoride movement

    • 19F NMR Spectroscopy: Direct observation of fluoride in different environments

    • Ion Chromatography: Precise quantification of fluoride concentrations

  • Kinetic Analysis Approaches:

    ParameterMethodologyInformation Gained
    Transport RateInitial rate measurements at varying [F-]Vmax, Km for transport
    Ion SelectivityCompetition with other anionsSelectivity profile
    pH DependenceTransport rates at varying pHInvolvement of proton coupling
    Temperature DependenceArrhenius plotsActivation energy for transport
    Inhibitor SensitivityEffect of known channel blockersPharmacological profile
  • Structure-Function Relationship Studies:

    • Site-Directed Mutagenesis: Systematic mutation of predicted pore-lining residues

    • Cysteine Scanning Accessibility: Identification of residues accessible to the transport pathway

    • Cross-linking Studies: Determination of subunit arrangement and oligomeric state

    • Voltage Dependence: Assessing if transport is electrogenic or electroneutral

  • Advanced Biophysical Techniques:

    • Stopped-Flow Fluorescence: Measuring pre-steady-state kinetics of transport

    • Solid-Supported Membrane Electrophysiology: For proteins difficult to study with conventional electrophysiology

    • Single-Molecule FRET: Detecting conformational changes during transport cycle

    • High-Speed Atomic Force Microscopy: Visualizing structural dynamics during transport

These integrated approaches would provide comprehensive insights into the fluoride transport mechanism of the CrcB homolog protein, particularly in the context of its function at high temperatures characteristic of T. petrophila's natural environment.

How can researchers effectively design experiments to investigate protein-protein interactions involving the CrcB homolog in a thermophilic context?

Investigating protein-protein interactions (PPIs) involving the CrcB homolog presents unique challenges due to its thermophilic nature and membrane localization. The following methodological framework addresses these challenges:

  • Candidate Interaction Partner Identification:

    ApproachMethodologyConsiderations for Thermophilic Proteins
    Bioinformatic PredictionGenomic context, co-expression analysisFocus on thermophilic-specific interaction patterns
    Pull-down MSAffinity-tagged CrcB coupled with mass spectrometryUse thermostable tags; perform at elevated temperatures
    Bacterial Two-HybridModified for membrane proteinsAdapt for thermophilic expression if possible
    Proximity LabelingBioID or APEX2 taggingEnsure enzyme activity at higher temperatures
  • Validation of Interactions in Thermophilic Conditions:

    • Co-immunoprecipitation: Perform lysate preparation and binding steps at elevated temperatures (40-60°C)

    • FRET Systems: Use thermostable fluorescent proteins or chemical fluorophores

    • Surface Plasmon Resonance: Temperature-controlled measurements up to 60-70°C

    • Isothermal Titration Calorimetry: Direct measurement of binding thermodynamics at relevant temperatures

  • Structural Characterization of Interaction Interfaces:

    • Cross-linking Mass Spectrometry: Chemical cross-linking optimized for thermophilic conditions

    • Hydrogen-Deuterium Exchange MS: Identifies protected regions upon complex formation

    • Cryo-EM of Protein Complexes: Visualization of assembled complexes

    • NMR Studies: Focus on specific domains using selective labeling approaches

  • Functional Validation Strategies:

    StrategyImplementationOutput Measurement
    Co-expression AnalysisExpress CrcB with putative partnersAltered fluoride transport activity
    Dominant Negative ApproachesExpress interaction-deficient mutantsDisruption of native function
    Split-protein ComplementationFragments of reporter proteins fused to interaction partnersSignal generated upon interaction
    Genetic Interaction StudiesDouble knockout/knockdown analysisSynthetic phenotypes indicating functional relationships
  • Experimental Design Considerations for Thermophilic Membrane Protein Interactions:

    • Temperature Control: Maintain appropriate temperatures throughout experimental procedures

    • Membrane Environment: Include appropriate lipids or membrane mimetics

    • Detergent Selection: Use detergents compatible with both interaction analysis and thermostability

    • Control Experiments: Include non-interacting thermophilic proteins as negative controls

    • Quantitative Analysis: Determine binding constants at various temperatures to understand thermodynamics

By systematically applying these approaches while accounting for the thermophilic nature of the CrcB homolog, researchers can effectively map its protein interaction network and understand how these interactions contribute to fluoride homeostasis in T. petrophila.

What computational approaches are recommended for modeling the structure and function of the CrcB homolog protein?

Computational modeling of the T. petrophila CrcB homolog requires specialized approaches that account for both its membrane protein nature and thermophilic characteristics:

  • Homology Modeling and Structural Prediction:

    MethodApplicationSpecial Considerations
    AlphaFold2De novo structure predictionIncorporate thermophilic-specific parameters
    SWISS-MODELTemplate-based modelingSelect templates from thermophilic organisms when available
    Rosetta MembraneSpecialized membrane protein modelingAdjust energy functions for high-temperature conditions
    CABS-foldCoarse-grained modelingUseful for predicting flexible regions
    Model ValidationPROCHECK, VERIFY3D, QMEANBraneEnsure validity in membrane context
  • Molecular Dynamics Simulations:

    • System Setup: Embed protein in explicit lipid bilayers that mimic T. petrophila membranes

    • Force Field Selection: CHARMM36m or Amber ff14SB with lipid parameters

    • Temperature Considerations: Run simulations at elevated temperatures (353K/80°C) to mimic native conditions

    • Simulation Types:

      • Equilibrium MD (100ns-1μs) for stability assessment

      • Steered MD for studying fluoride permeation

      • Replica exchange MD for enhanced sampling at high temperatures

  • Ion Permeation and Selectivity Modeling:

    • Potential of Mean Force Calculations: Energy profiles for ion translocation

    • Brownian Dynamics: Ion conductance simulations

    • Quantum Mechanics/Molecular Mechanics: Detailed electronic structure of binding sites

    • Markov State Models: Identifying metastable states during transport

  • Dynamics and Flexibility Analysis:

    Analysis TypeInformation Gained
    Principal Component AnalysisMajor collective motions
    Normal Mode AnalysisIntrinsic flexibility patterns
    Dynamic Cross-Correlation MapsCorrelated motions between domains
    Hydrogen Bond AnalysisStability of key interactions at high temperatures
    Water and Ion OccupancyIdentification of binding sites and permeation pathway
  • Integration with Experimental Data:

    • Refinement of models using distance constraints from PELDOR/DEER data

    • Validation with 19F ENDOR measurements of the fluoride binding environment

    • Correlation with mutagenesis data on transport function

    • Integration with mass spectrometry data for identifying flexible regions

These computational approaches provide valuable insights into the structural basis of CrcB function, particularly its adaptation to high temperatures and mechanism of fluoride selectivity, complementing and guiding experimental investigations.

How can researchers design effective mutagenesis strategies to probe the functional mechanisms of the CrcB homolog?

A systematic mutagenesis approach is crucial for elucidating the structure-function relationships of the CrcB homolog:

  • Targeted Mutagenesis Strategies:

    StrategyApproachFunctional Insights
    Alanine ScanningReplace consecutive residues with alanineIdentifies essential residues for function
    Charge ReversalChange positive to negative residues and vice versaTests electrostatic interactions in ion coordination
    Conservative SubstitutionsReplace with similar amino acidsProbes specific chemical requirements
    Introduction of Cysteine PairsStrategic placement for disulfide formationTests proximity of residues and conformational changes
    Thermostability MutationsReplace thermolabile residuesIdentifies residues critical for high-temperature stability
  • Priority Regions for Mutagenesis:

    • Predicted transmembrane segments likely to form the fluoride permeation pathway

    • Residues conserved across CrcB homologs in different thermophilic species

    • Charged or polar residues that might coordinate fluoride ions

    • Residues at putative subunit interfaces if the protein functions as an oligomer

    • Sites predicted to undergo conformational changes during transport cycle

  • Experimental Design for Mutant Analysis:

    Assay TypeMethodologyMutant Phenotype Assessment
    Expression AnalysisWestern blotting, fluorescent tagsProtein production and stability
    Localization StudiesFluorescence microscopy, membrane fractionationProper membrane targeting
    Fluoride TransportLiposome-based flux assaysDirect functional measurement
    Growth ComplementationExpression in fluoride-sensitive strainsIn vivo functional assessment
    Structural ImpactCircular dichroism, limited proteolysisEffects on protein folding and stability
  • Advanced Mutagenesis Approaches:

    • Double Mutant Cycle Analysis: Identifying cooperativity between residues

    • Unnatural Amino Acid Incorporation: Introducing novel chemical properties or photocrosslinking

    • Domain Swapping: Exchange domains with other CrcB homologs to identify specificity determinants

    • Random Mutagenesis and Screening: Directed evolution for enhanced properties

  • Data Analysis Framework:

    • Quantitative comparison of mutant activities relative to wild-type protein

    • Correlation of functional effects with structural predictions

    • Classification of mutations as affecting expression, stability, or specific functional steps

    • Integration with computational models to refine understanding of mechanism

A comprehensive mutagenesis strategy targeting the CrcB homolog would provide critical insights into the molecular basis of fluoride transport and selectivity, as well as the structural adaptations that enable function at the extreme temperatures characteristic of T. petrophila's natural environment.

What are the emerging research directions for understanding thermophilic membrane proteins like the CrcB homolog?

The study of thermophilic membrane proteins such as the T. petrophila CrcB homolog represents a frontier in structural and functional biology, with several emerging research directions:

  • Integration of Advanced Structural Methods:

    • Time-resolved structural studies capturing transport dynamics

    • Cryo-EM advances enabling high-resolution structures of smaller membrane proteins

    • In situ structural determination within native-like environments

    • Neutron scattering approaches to understand hydration and hydrogen bonding

  • Single-Molecule Biophysics Applications:

    • Single-molecule FRET to track conformational changes during transport

    • High-speed AFM visualization of protein dynamics

    • Nanopore-based electrical recordings of individual transporters

    • Optical tweezers measurements of force generation during conformational changes

  • Systems Biology Integration:

    • Multi-omics approaches to understand CrcB in the context of cellular networks

    • Network modeling of ion homeostasis in thermophiles

    • Comparative genomics across extremophiles with different temperature optima

    • Evolutionary trajectory mapping through ancestral sequence reconstruction

  • Biotechnological Applications Development:

    • Engineering enhanced thermostability for industrial applications

    • Development of fluoride biosensors for high-temperature environments

    • Creation of chimeric proteins with novel functions

    • Incorporation into synthetic biological systems for environmental monitoring

  • Methodological Advances for Thermophilic Membrane Proteins:

    • High-temperature structural biology techniques

    • Specialized expression and purification platforms

    • Membrane mimetics optimized for thermophilic proteins

    • Computational tools specifically parameterized for high-temperature conditions

These emerging directions will advance our fundamental understanding of how membrane proteins function in extreme environments and enable novel applications leveraging their unique properties.

How can knowledge gained from studying the CrcB homolog contribute to our broader understanding of extremophile biology?

Research on the T. petrophila CrcB homolog provides valuable insights that extend beyond this specific protein:

  • Principles of Protein Thermostability:

    • Identification of specific amino acid compositions and arrangements that confer thermal stability

    • Understanding how membrane proteins maintain function at extreme temperatures

    • Elucidation of the balance between structural rigidity for stability and flexibility for function

    • Insights into how ion selectivity mechanisms operate at high temperatures

  • Extremophile Adaptation Mechanisms:

    • How organisms like T. petrophila maintain ion homeostasis in extreme environments

    • Regulatory strategies (like the fluoride riboswitch) adapted to function at high temperatures

    • Membrane composition and adaptation for extremophilic conditions

    • Integration of stress response systems in organisms facing multiple extreme conditions

  • Evolutionary Perspectives:

    • Insights into how essential functions are maintained despite extensive genomic recombination

    • Understanding of convergent evolution in thermophilic organisms

    • Reconstruction of adaptation pathways to extreme environments

    • Elucidation of ancient protein functions in deeply branching bacterial lineages like Thermotogota

  • Implications for Early Life and Astrobiology:

    • Models for how ion transport systems could function in early Earth conditions

    • Insights relevant to potential life in extreme environments on other planets

    • Understanding the limits of biological adaptation to extreme conditions

    • Development of biosignatures for detecting life in extreme environments

  • Biotechnological Applications Beyond the CrcB Protein:

    • General principles for engineering thermostable proteins

    • Design strategies for membrane proteins in industrial settings

    • Development of extremophile-based biotechnological platforms

    • Inspiration for synthetic biology approaches to creating organisms for extreme environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.