Recombinant Thermotoga petrophila Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Source Organism: Thermotoga petrophila

Thermotoga petrophila, the source organism for uppP, belongs to a genus of hyperthermophilic bacteria known for their remarkable thermal tolerance. This species was originally isolated from oil reservoir production fluid in Niigata, Japan, an environment characterized by extreme temperature conditions . As a hyperthermophile, T. petrophila thrives at an optimal temperature of 80°C, making it an excellent source for thermostable enzymes with industrial potential .

Taxonomic and Genomic Context

T. petrophila demonstrates significant genomic similarity to related Thermotoga species, sharing 99.2% 16S rRNA identity with Thermotoga maritima, the type species of the genus . The organism's genome contains 1,785 protein-coding open reading frames (ORFs), including numerous genes associated with carbohydrate utilization and other metabolic functions adapted to extreme environments . The table below illustrates the taxonomic and physiological comparison of T. petrophila with other Thermotoga species:

Species or strainIsolation siteLocationT opt (°C)% 16S rRNA identity to T. maritimaNo. of protein-coding ORFs
T. maritimaGeothermally heated sea floorVulcano, Italy801001,858
T. petrophilaOil reservoir production fluidNiigata, Japan8099.21,785
T. naphthophilaOil reservoir production fluidNiigata, Japan8099.01,768
T. neapolitanaSubmarine thermal ventNaples, Italy7799.41,905

This taxonomic positioning provides important context for understanding the evolutionary adaptations that contribute to the exceptional thermostability of T. petrophila enzymes, including uppP.

Functional Role in Bacterial Cell Wall Biosynthesis

Undecaprenyl-diphosphatase serves a critical function in bacterial cell wall biosynthesis, specifically in the peptidoglycan synthesis pathway. The enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to form undecaprenyl phosphate (UP), a crucial carrier lipid involved in the transport of peptidoglycan precursors across the cytoplasmic membrane .

Biochemical Pathway and Reaction Mechanism

The biosynthetic pathway involving Undecaprenyl-diphosphatase represents a critical sequence in bacterial cell envelope formation. Initially, farnesyl diphosphate synthase (FPPS) catalyzes the production of farnesyl pyrophosphate (FPP) . Subsequently, undecaprenyl diphosphate synthase (UPPS) facilitates the condensation of FPP with eight additional isopentenyl pyrophosphate (IPP) molecules, forming undecaprenyl diphosphate (UPP) . The final transformation in this sequence is catalyzed by undecaprenyl diphosphate phosphatase (UPPP, encoded by the uppP gene), which converts UPP to undecaprenyl phosphate (UP) . This reaction can be represented as:

Undecaprenyl diphosphate + H₂O → Undecaprenyl phosphate + Inorganic phosphate

The enzyme's catalytic activity is classified under EC 3.6.1.27, indicating its role in hydrolysis of phosphoric-anhydride bonds in pyrophosphates .

Expression and Production of Recombinant T. petrophila uppP

The production of recombinant Thermotoga petrophila Undecaprenyl-diphosphatase typically employs standard recombinant DNA technology adapted for thermophilic proteins. While specific expression conditions for T. petrophila uppP are not detailed in the provided search results, general methods for expressing recombinant proteins from Thermotoga species provide valuable insights.

Expression Systems and Optimization

Expression of recombinant proteins from hyperthermophilic organisms like Thermotoga species commonly utilizes E. coli-based expression systems with appropriate modifications. The DNA isolation from T. petrophila would likely follow methods similar to those described for T. maritima, where biomass is grown anaerobically on glucose and yeast extract at elevated temperatures . Standard procedures for DNA manipulation, competent cell preparation, and transformation would follow established protocols for thermophilic organisms .

Purification and Heat Treatment

A distinctive advantage of proteins from hyperthermophilic organisms is the possibility of using heat precipitation as a purification step. This approach exploits the thermostability of target proteins while denaturing the majority of host cell proteins. The table below illustrates heat treatment conditions used for various recombinant thermophilic proteins, providing a reference framework for potential purification strategies for T. petrophila uppP:

Recombinant proteinNative organismHeat-precipitationT opt (°C)
Glutaredoxin-like proteinPyrococcus furiosus65°C for 10 min100
The HU proteinThermotoga maritima80°C for 20 min80
Phosphoglycerate kinaseThermotoga maritima60 min at 80°C80
Chemotaxis proteinThermotoga maritima80°C for 10 min80
Maltose-binding proteinThermotoga maritima75°C for 30 min80

Given that T. petrophila has an optimal growth temperature of 80°C, similar to T. maritima, heat treatment protocols in the range of 75-80°C for 10-30 minutes might be appropriate for purification of recombinant uppP.

Thermostability and Biophysical Properties

The thermostability of enzymes from Thermotoga species is well-documented, making them valuable for biotechnological applications requiring robust catalytic activity at elevated temperatures. While specific biophysical characterization data for T. petrophila uppP is not available in the search results, insights can be drawn from studies of other enzymes from this organism.

Comparative Thermostability

T. petrophila enzymes often exhibit remarkable thermostability, as exemplified by a novel arabinanase (AbnA) isolated from this organism. This enzyme maintained significant residual activity even after incubation at temperatures up to 90°C . Such thermostability is characteristic of proteins from hyperthermophilic organisms and suggests that uppP from T. petrophila likely possesses similar heat resistance properties.

Potential Applications and Significance

The recombinant T. petrophila Undecaprenyl-diphosphatase holds considerable potential for both research and applied contexts, particularly due to its role in bacterial cell wall biosynthesis and its thermostable properties.

Antimicrobial Drug Development

Undecaprenyl diphosphate synthase (UPPS) and phosphatase (UPPP) represent attractive targets for antimicrobial drug development since these pathways are essential for bacterial cell wall synthesis but are not utilized by humans . Inhibitors targeting these enzymes, including tetramic acids, tetronic acids, diamidines, and benzoic acids, have been investigated for their potential antibacterial properties . The availability of recombinant T. petrophila uppP facilitates screening and development of such inhibitors.

Industrial Enzyme Applications

The exceptional thermostability of T. petrophila enzymes makes them valuable for industrial processes requiring elevated temperatures. Enzymes that maintain activity at high temperatures offer advantages including increased reaction rates, reduced risk of microbial contamination, and enhanced substrate solubility. The recombinant production of uppP enables its potential application in processes that benefit from these thermophilic properties.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery details.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
uppP; Tpet_0034; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995)
Target Names
uppP
Target Protein Sequence
MDLLLGIIQGLTEFLPVSSSGHLTLLSHLLKTDLNAYQTAVLHLGTLVSVVLFAFDGIRR SLRSWRIILNLIVSTIPAGVFGVLFEKQIDQLFSSPRFLPLFFSVTALILMFTRYSSSGE KRMENMSFLDALLVGIAQLFALFPGISRSGITVSSLLFMKYRGEDALQYSFLMSIPVVLG AGILGLEKGNITILAPIFAFLSGLFALYVLSRSVRSGKIWQFSYYCLFVAILSYLVG
Uniprot No.

Target Background

Function
This protein catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). It confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Expression and Purification Methodologies

2.1. What expression systems are most effective for producing recombinant T. petrophila uppP?

While the search results don't specifically detail expression systems for T. petrophila uppP, effective expression systems can be inferred from successful approaches with other Thermotoga proteins. Escherichia coli expression systems using vectors such as pHIS-parallel1 have proven effective for other recombinant proteins from T. petrophila . For membrane proteins like uppP, E. coli strains specifically designed for membrane protein expression (such as C41(DE3) or C43(DE3)) would likely be advantageous. Expression conditions should be optimized to include lower induction temperatures (15-25°C) and extended expression times to facilitate proper folding of this thermostable protein.

2.2. What purification strategies yield the highest purity and activity for recombinant T. petrophila uppP?

Purification of T. petrophila uppP should incorporate strategies suitable for both membrane proteins and thermostable enzymes. A recommended approach includes:

  • Affinity chromatography: Using a fusion tag (typically His-tag) for initial capture

  • Detergent extraction: Employing mild detergents (e.g., n-dodecyl-β-D-maltoside) to solubilize the membrane-associated protein

  • Size exclusion chromatography: As a polishing step to remove aggregates and impurities

  • Heat treatment: Exploiting the thermostability of T. petrophila proteins by heating samples (70-80°C) to precipitate less stable E. coli proteins

Throughout the purification process, buffers should include stabilizers such as glycerol (30-50%) to maintain protein integrity .

2.3. What are the optimal storage conditions to maintain activity of purified T. petrophila uppP?

Purified T. petrophila uppP should be stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein . For extended storage, -20°C or -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided as they can compromise protein structure and activity. Single-use aliquots are advisable for experimental work requiring consistent enzyme performance.

Enzymatic Analysis and Characterization

3.1. What assay methods are most reliable for measuring T. petrophila uppP activity?

For assaying T. petrophila uppP activity, researchers should consider the following methodology:

  • Substrate preparation: Undecaprenyl diphosphate or suitable synthetic analogs

  • Reaction conditions:

    • Temperature: 80°C (optimal for T. petrophila proteins)

    • pH: ~7.0 (optimal for T. petrophila growth)

    • Buffer: Heat-stable buffers (PIPES or HEPES) with reduced ionic strength

  • Activity detection: Measurement of released inorganic phosphate using:

    • Colorimetric methods (malachite green assay) adapted for high temperatures

    • HPLC-based methods for direct quantification of dephosphorylated product

  • Controls: Include heat-inactivated enzyme and substrate stability controls

The assay should account for the extreme temperature optimum of T. petrophila enzymes, with appropriate controls for non-enzymatic hydrolysis which can be significant at elevated temperatures.

3.2. How do the kinetic parameters of T. petrophila uppP compare with mesophilic homologs?

While specific kinetic parameters for T. petrophila uppP are not detailed in the provided references, extrapolation from studies of other thermostable enzymes from this organism suggests distinctive kinetic behavior. Based on kinetic studies of other T. petrophila enzymes, the following comparative framework can be proposed:

ParameterExpected Trend for T. petrophila uppPExplanation
Temperature optimum~80°C vs. 30-37°C for mesophilic enzymesReflects adaptation to the organism's growth temperature
pH optimumLikely broader than mesophilic counterpartsThermostable enzymes often show wider pH stability
KmPotentially higher at moderate temperaturesMay reflect structural rigidity at non-optimal temperatures
kcatLower at moderate temperatures, higher at elevated temperaturesCatalytic rate increases with temperature until denaturation
Thermal stability (half-life)Significantly extended at 60-80°CInherent thermostability of proteins from hyperthermophiles

For precise comparative analysis, researchers should conduct parallel kinetic studies at various temperatures (30-90°C) with uppP enzymes from multiple sources.

3.3. What thermodynamic parameters characterize the stability of T. petrophila uppP?

The thermodynamic parameters that likely characterize T. petrophila uppP, based on studies of other thermostable proteins from this organism, include:

  • Activation energy (Ea): Expected to be in the range of 40-50 kJ/mol for catalysis, similar to the 42.9 kJ/mol reported for other T. petrophila enzymes

  • Free energy change (ΔG): Approximately 70-80 kJ/mol at optimal temperature, comparable to the 74 kJ/mol reported for other T. petrophila enzymes

  • Enthalpy change (ΔH): Likely around 40 kJ/mol, similar to the 39.9 kJ/mol reported for other enzymes from this organism

  • Entropy change (ΔS): Expected to be negative (approximately -90 to -100 J/mol·K), consistent with the -92.3 J/mol·K reported for other T. petrophila enzymes

For thermal inactivation, the activation energy (EaD) would likely be much higher (~100-110 kJ/mol), reflecting the substantial energy barrier that must be overcome to denature this thermostable protein .

Advanced Research Applications

4.1. How can site-directed mutagenesis be applied to investigate structure-function relationships in T. petrophila uppP?

A comprehensive mutagenesis approach for T. petrophila uppP should include:

  • Target identification:

    • Sequence alignment with homologous proteins to identify conserved catalytic residues

    • Structural prediction to identify membrane-spanning domains and active site residues

    • Identification of residues unique to thermophilic versions versus mesophilic homologs

  • Mutation design strategy:

    • Conservative substitutions to probe specific interactions (e.g., D→E, K→R)

    • Non-conservative substitutions to disrupt interactions (e.g., D→A, K→A)

    • Introduction of residues common in mesophilic homologs to test thermostability determinants

  • Experimental validation:

    • Activity assays at various temperatures (40-90°C) to distinguish effects on catalysis versus stability

    • Thermal inactivation studies to determine changes in half-life at elevated temperatures

    • Structural characterization using circular dichroism spectroscopy to assess conformational changes

This systematic approach would reveal residues critical for catalysis, membrane association, and thermostability, providing insights into the molecular adaptations that enable function at extreme temperatures.

4.2. What computational approaches can predict substrate binding specificity of T. petrophila uppP?

Advanced computational approaches to investigate T. petrophila uppP substrate specificity include:

  • Homology modeling:

    • Construction of 3D models based on crystal structures of related phosphatases

    • Refinement with molecular dynamics simulations at elevated temperatures (80°C) to capture thermodynamic conditions

  • Molecular docking:

    • Virtual screening of substrate analogs and inhibitors

    • Calculation of binding energies at various temperatures

    • Identification of key protein-ligand interactions

  • Molecular dynamics simulations:

    • Analysis of substrate binding pocket flexibility at different temperatures

    • Investigation of water organization around the active site

    • Calculation of free energy profiles along the reaction coordinate

  • Quantum mechanics/molecular mechanics (QM/MM):

    • Investigation of the reaction mechanism

    • Calculation of activation barriers for different substrates

    • Comparison with experimental kinetic data

These computational approaches, validated with experimental data, can provide atomistic insights into substrate recognition and catalysis mechanisms unique to this thermostable enzyme.

4.3. How can T. petrophila uppP be engineered for enhanced thermostability or altered substrate specificity?

Engineering T. petrophila uppP for enhanced properties could employ multiple strategies:

  • Directed evolution approaches:

    • Error-prone PCR to generate libraries with random mutations

    • Selection under conditions of extreme temperature or altered substrate availability

    • High-throughput screening assays to identify variants with desired properties

  • Rational design strategies:

    • Introduction of additional salt bridges at the protein surface

    • Optimization of surface charge distribution

    • Proline substitutions in loop regions to reduce flexibility

    • Disulfide bond engineering to enhance structural rigidity

  • Semi-rational approaches:

    • Consensus design based on alignment of multiple thermophilic phosphatases

    • Ancestral sequence reconstruction to identify thermostabilizing mutations

    • Domain swapping with other thermostable enzymes

  • Substrate specificity engineering:

    • Focused mutagenesis of active site residues

    • Loop grafting from related enzymes with different specificities

    • Computational design of the substrate binding pocket

Each approach should be followed by rigorous characterization of the engineered variants under various conditions to verify the intended improvements.

Comparative Genomics and Evolution

5.1. How does T. petrophila uppP compare genomically with homologs from other Thermotoga species?

T. petrophila uppP likely shares significant sequence homology with other Thermotoga species, while maintaining species-specific adaptations. Comparative genomic analysis would reveal:

  • Sequence conservation: High sequence identity (likely >80%) within the Thermotoga genus, particularly among closely related species like T. maritima and T. naphthophila

  • Genomic context: The uppP gene (Tpet_0034) in T. petrophila likely exists in a similar genomic neighborhood to homologs in other Thermotoga species, potentially clustering with other genes involved in cell wall synthesis

  • Divergence patterns: Despite high conservation of catalytic residues, variability may exist in regions contributing to membrane association or thermal stability

The genome size of Thermotoga species is typically around 1.8-1.9 Mbp with a G+C content of approximately 46-47% , and the uppP gene would represent one of approximately 1800-1900 protein-coding genes in the genome.

5.2. What evidence exists for horizontal gene transfer involving T. petrophila uppP or related genes?

While specific evidence for horizontal gene transfer (HGT) of the uppP gene is not detailed in the search results, T. petrophila and other Thermotoga species show significant evidence of HGT. For example:

  • Plasmid transfer: A plasmid (pRKU1) from T. petrophila RKU-1 shows 99% sequence identity to plasmid pRQ7 from the distantly related Thermotoga sp. strain RQ7, despite only 72% identity in their shared protein-coding sequences . This demonstrates recent HGT events in Thermotoga.

  • Potential mechanisms: The search results indicate that this plasmid has been found in multiple Thermotoga strains isolated from geographically distant regions, suggesting active mechanisms for genetic exchange exist despite the extreme environments these organisms inhabit .

  • Implications for uppP: While not specifically documented for uppP, the documented HGT events in Thermotoga suggest that genes conferring selective advantages (such as antibiotic resistance associated with uppP) could potentially be transferred between species.

Researchers interested in evolutionary history of uppP should conduct detailed phylogenetic analyses comparing uppP sequences with the established species phylogeny based on conserved markers like 16S rRNA.

Troubleshooting Experimental Challenges

6.1. How can researchers address low expression yields of recombinant T. petrophila uppP?

Low expression yields of T. petrophila uppP may result from several factors that can be addressed through systematic optimization:

  • Codon optimization:

    • Analyze codon usage bias between T. petrophila and expression host

    • Synthesize a codon-optimized gene for the expression system

    • Consider rare codon supplementation (using strains like Rosetta)

  • Expression conditions optimization:

    • Test multiple induction temperatures (15°C, 20°C, 25°C, 30°C)

    • Vary inducer concentration (0.01-1.0 mM IPTG)

    • Examine different media formulations (LB, TB, auto-induction)

    • Optimize cell density at induction (OD600 of 0.4-0.8)

  • Fusion partner strategies:

    • Test multiple fusion tags (His, MBP, SUMO, GST)

    • Evaluate different tag positions (N-terminal vs. C-terminal)

    • Consider dual tagging approaches for enhanced solubility and purification

  • Host strain selection:

    • Screen multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta)

    • Consider expression in other bacterial hosts for membrane proteins

  • Vector design:

    • Test promoter strength (T7 vs. tac vs. arabinose-inducible)

    • Evaluate different signal sequences for membrane targeting

    • Consider low-copy vs. high-copy plasmid backbones

Systematic optimization using these approaches should significantly improve expression yields for this challenging membrane protein.

6.2. What strategies can address protein insolubility or aggregation during purification of T. petrophila uppP?

For addressing insolubility or aggregation of T. petrophila uppP during purification:

  • Membrane protein extraction:

    • Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations

    • Test different extraction times and temperatures

    • Consider detergent mixtures for improved solubilization

  • Buffer optimization:

    • Evaluate various pH conditions (pH 6.0-8.5)

    • Test different salt concentrations (100-500 mM)

    • Include stabilizing additives (glycerol, reducing agents, specific lipids)

  • Refolding strategies (if required):

    • Develop on-column refolding protocols

    • Use step-wise dialysis with decreasing denaturant concentrations

    • Add lipids or detergent micelles during refolding

  • Aggregation prevention:

    • Maintain protein at moderate concentrations (<5 mg/ml)

    • Include anti-aggregation additives (arginine, low concentrations of urea)

    • Consider fusion to solubility-enhancing partners

  • Quality assessment:

    • Monitor aggregation using dynamic light scattering

    • Assess homogeneity by size exclusion chromatography

    • Verify proper folding using circular dichroism spectroscopy

These approaches should be tested systematically, with each variable optimized while keeping others constant to identify the most effective conditions.

6.3. How can researchers troubleshoot inconsistent enzymatic activity in purified T. petrophila uppP preparations?

Inconsistent enzymatic activity in purified T. petrophila uppP preparations may stem from several factors that can be systematically addressed:

  • Protein quality assessment:

    • Confirm protein integrity by SDS-PAGE and western blotting

    • Verify proper folding using circular dichroism spectroscopy

    • Assess oligomerization state using size exclusion chromatography

  • Activity assay validation:

    • Include positive controls (commercial phosphatases)

    • Establish linear range for enzyme concentration and reaction time

    • Verify substrate stability under assay conditions

    • Include appropriate blanks and controls for non-enzymatic hydrolysis

  • Buffer and cofactor requirements:

    • Test divalent cation dependencies (Mg²⁺, Mn²⁺, Ca²⁺)

    • Evaluate potential inhibitory effects of buffer components

    • Include reducing agents if disulfide formation affects activity

  • Storage condition optimization:

    • Compare activity retention in different storage buffers

    • Assess stability at various temperatures (-80°C, -20°C, 4°C)

    • Evaluate the impact of freeze-thaw cycles

    • Test protein stabilizers (glycerol, sucrose, specific lipids)

  • Membrane environment reconstitution:

    • Experiment with different detergent types and concentrations

    • Consider reconstitution into liposomes or nanodiscs

    • Test activity in the presence of specific lipids from thermophiles

By systematically addressing these factors, researchers can identify the critical parameters for maintaining consistent enzymatic activity of this thermostable membrane protein.

Emerging Research Directions

7.1. What are the potential biotechnological applications of T. petrophila uppP?

T. petrophila uppP offers several promising biotechnological applications based on its thermostability and enzymatic function:

  • Antimicrobial drug discovery:

    • Use as a model for structure-based design of novel bacitracin-like antibiotics

    • Development of high-throughput screening platforms for inhibitor discovery

    • Creation of temperature-resistant biosensors for antibiotic compounds

  • Cell wall biosynthesis studies:

    • Development of thermostable tools for investigating peptidoglycan assembly

    • Creation of enzymatic cascades for synthesizing cell wall components

    • Utilization in structural studies of membrane-associated biosynthetic complexes

  • Biocatalysis applications:

    • Adaptation for industrial dephosphorylation reactions requiring high temperatures

    • Integration into multi-enzyme cascades for complex polysaccharide modification

    • Development of immobilized enzyme systems with extended operational stability

  • Thermostability engineering platform:

    • Use as a model system for developing general principles of protein thermostabilization

    • Template for engineering thermostability into mesophilic homologs

    • Basis for computational algorithms predicting stabilizing mutations

These applications leverage the unique properties of this enzyme from a hyperthermophilic organism adapted to extreme environmental conditions.

7.2. How might structural characterization of T. petrophila uppP advance understanding of membrane protein thermostability?

Structural characterization of T. petrophila uppP would provide valuable insights into membrane protein thermostability mechanisms:

  • Membrane-protein interface adaptations:

    • Identification of specialized residue patterns at membrane interfaces

    • Characterization of lipid-binding motifs that enhance stability

    • Understanding of hydrophobic packing adaptations in transmembrane regions

  • Thermostability determinants:

    • Quantification of salt bridge networks and their contribution to stability

    • Analysis of reduced loop flexibility in thermostable membrane proteins

    • Identification of water-exclusion mechanisms in the protein core

  • Methodological advances:

    • Development of improved crystallization techniques for thermostable membrane proteins

    • Refinement of computational models for predicting membrane protein stability

    • Advancement of NMR methodologies for membrane protein structural studies at high temperatures

  • Comparative structural biology:

    • Identification of structural features distinguishing thermophilic from mesophilic membrane proteins

    • Understanding evolutionary adaptations for membrane association at high temperatures

    • Development of structure-based rules for engineering thermostability

These findings would not only advance our understanding of this specific enzyme but also contribute to broader principles of protein engineering and membrane protein biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.