Recombinant Thermotoga sp. ATP synthase subunit b (atpF)

What is Thermotoga sp. ATP synthase subunit b (atpF) and what is its role in cellular energy metabolism?

ATP synthase subunit b (atpF) from Thermotoga sp. is a component of the F-type ATP synthase complex, which functions as a molecular nanomotor that catalyzes ATP synthesis driven by proton motive force. The protein serves as part of the F₀ membrane-embedded sector of ATP synthase, contributing to the stator assembly that holds the catalytic F₁ sector in place while allowing rotation of the central stalk.

In Thermotoga species, this protein is particularly important for energy metabolism under extreme conditions, as these hyperthermophilic anaerobic bacteria thrive at temperatures approaching 80°C. The atpF subunit has specific adaptations that maintain structural integrity and function at elevated temperatures, making it significant for understanding extremophile energy metabolism .

What is the molecular structure and key features of recombinant Thermotoga sp. ATP synthase subunit b (atpF)?

Recombinant Thermotoga sp. ATP synthase subunit b (atpF) is a protein of 164 amino acids with a hydrophobic N-terminal region that anchors the protein in the membrane and a more hydrophilic C-terminal region that extends into the cytoplasm. The full amino acid sequence is:

MGFLEINWTSAAMLMLFVLMVYFLNKFLYTPFIEMAEKRRKKVEEDLKSAEQLKEEAEKMRSEAERFLSEARQRADEIVESARKEAEAIVEEAREKAKKEAQNIVESAKTQIEVEYKK ALEQVQERAAELSVILATKLLQKVFQDERARREYLVKILKEEIEKS

The protein contains characteristic features that contribute to thermostability, including a high content of charged residues that can form salt bridges, and hydrophobic core interactions that maintain structural integrity at high temperatures. The recombinant version typically includes a tag for purification purposes, though the specific tag type may vary depending on the production process .

How does the ATP synthase complex from Thermotoga species differ from those of mesophilic organisms?

ATP synthase complexes from Thermotoga species exhibit several structural and functional adaptations that distinguish them from their mesophilic counterparts:

• Enhanced thermostability: The protein subunits, including atpF, contain modifications that increase stability at high temperatures, such as increased hydrophobic interactions, additional salt bridges, and more compact packing of amino acid residues.

• Membrane composition adaptability: The F₀ sector interfaces with a membrane that must remain fluid yet stable at extreme temperatures, requiring special lipid-protein interactions.

• Energy coupling efficiency: Thermotoga ATP synthases maintain efficient energy coupling despite the high thermal energy in their natural environment, which could potentially dissipate the proton gradient.

• Regulatory differences: In some Thermotoga species like T. neapolitana and T. sp. strain RQ7, V-ATPase (which couples ATP hydrolysis to proton transport) is upregulated, while it is absent in T. maritima, suggesting different regulatory mechanisms for maintaining proton gradients across species .

These differences reflect evolutionary adaptations to extreme environments and provide valuable insights into protein structure-function relationships under thermal stress.

What mechanisms contribute to the thermostability of Thermotoga sp. ATP synthase subunit b (atpF), and how can these be experimentally verified?

The thermostability of Thermotoga sp. ATP synthase subunit b (atpF) is attributed to several molecular mechanisms:

• Increased hydrophobic core packing: Tighter packing of hydrophobic residues reduces the protein's conformational flexibility at high temperatures.

• Enhanced electrostatic interactions: Higher proportion of charged residues forming salt bridges that stabilize tertiary structure.

• Reduced loop regions: Fewer and shorter flexible loops minimize thermal denaturation initiation points.

• Strategic disulfide bonds: Potential disulfide bridges between cysteine residues (note that factor B in ATP synthase is known to be inactivated by thiol-modifying reagents, suggesting the importance of cysteine residues for function) .

These mechanisms can be experimentally verified through:

• Differential scanning calorimetry (DSC): To measure the protein's melting temperature and thermodynamic parameters.

• Site-directed mutagenesis: Systematically altering suspected stabilizing residues and measuring effects on thermostability.

• Structural analysis: X-ray crystallography or cryo-EM to determine atomic-resolution structures at different temperatures.

• Hydrogen-deuterium exchange mass spectrometry: To assess protein dynamics and identify regions of increased rigidity.

• Thiol-modification experiments: Using reagents like those described for factor B to test the role of cysteine residues in stability and function .

How does recombinant Thermotoga sp. ATP synthase subunit b (atpF) function within the context of capnophilic lactic fermentation (CLF), and what experimental approaches can elucidate its role?

Recent research has identified capnophilic lactic fermentation (CLF) in Thermotoga species, particularly T. neapolitana and T. sp. strain RQ7, but not in T. maritima. This CO₂-activated pathway enables simultaneous production of hydrogen and lactic acid. The ATP synthase complex, including the atpF subunit, likely plays a critical role in this process through maintaining proton gradients necessary for energy production .

The role of ATP synthase subunit b (atpF) in CLF can be investigated through:

• Comparative gene expression analysis: RT-PCR data shows that V-ATPase, which couples ATP hydrolysis to proton transport across membranes, is upregulated in CLF-performing Thermotoga strains but absent in T. maritima, suggesting its importance in maintaining proton gradients for simultaneous hydrogen and lactic acid production .

• Mutational studies: Creating atpF knockout or modified variants in naturally competent T. sp. strain RQ7 to observe effects on CLF performance.

• Bioenergetic measurements: Comparing proton motive force and ATP/ADP ratios in wild-type and atpF-modified strains under CO₂ conditions.

• Protein-protein interaction studies: Investigating whether atpF interacts with other CLF-related enzymes like PFOR, LDH, RNF, and NFN that are upregulated in CLF-performing strains .

A proposed experimental workflow could include creating atpF variants with different thermostability properties and assessing their impact on hydrogen and lactic acid production under CO₂ atmosphere, providing insights into how ATP synthase structure influences metabolic versatility.

What role might post-translational modifications play in regulating Thermotoga sp. ATP synthase subunit b (atpF) function, and how can these be characterized?

Post-translational modifications (PTMs) of ATP synthase subunit b may serve as regulatory mechanisms affecting protein function, particularly under different environmental conditions. Potential PTMs include:

• Phosphorylation: Could regulate assembly or activity of the ATP synthase complex.

• Acylation: Might influence membrane association or protein-protein interactions.

• Thiol-based modifications: Given the sensitivity of factor B to thiol-modifying reagents in ATP synthase , cysteine modifications could be important for Thermotoga sp. atpF.

• Thermal-induced modifications: Unique PTMs that provide protection at extreme temperatures.

Characterization approaches include:

Experiments comparing PTMs under different growth conditions (temperature, CO₂ levels) could reveal how these modifications contribute to adaptive responses in extremophiles. Mass spectrometry analysis of purified recombinant protein versus native protein from Thermotoga cells would also reveal which modifications are physiologically relevant versus artifacts of recombinant expression.

What are the optimal conditions for expression and purification of functional recombinant Thermotoga sp. ATP synthase subunit b (atpF)?

Successful expression and purification of functional recombinant Thermotoga sp. ATP synthase subunit b (atpF) requires careful optimization of several parameters:

Expression System Options:

• E. coli: Most commonly used, with BL21(DE3) or similar strains suitable for expression .

• Yeast: Alternative for certain modifications.

• Baculovirus/insect cells: For complex folding requirements.

• Mammalian cells: Rarely needed but available if specific modifications are required .

Optimized Expression Protocol:

• Vector selection: pET series vectors with T7 promoter system work well for thermophilic proteins.

• Induction conditions: Lower temperatures (15-25°C) despite the thermophilic origin, as this reduces inclusion body formation.

• Induction time: Extended expression (overnight) at lower temperatures often yields better results than short, high-temperature induction.

• Media supplementation: Addition of rare codons tRNA if the Thermotoga sequence contains codons rare in E. coli.

Purification Strategy:

• Initial extraction: Use of mild detergents for membrane protein extraction.

• Affinity chromatography: Utilizing an appropriate tag (His-tag commonly used).

• Ion exchange chromatography: To remove contaminants.

• Size exclusion chromatography: Final polishing step.

Storage Conditions:

• Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage.

• Working aliquots can be maintained at 4°C for up to one week.

• Avoid repeated freeze-thaw cycles as they may affect protein stability .

The purified protein should achieve >90% purity as assessed by SDS-PAGE and maintain its native conformation as verified by circular dichroism or other structural analysis methods.

What assays can be used to evaluate the functional activity of recombinant Thermotoga sp. ATP synthase subunit b (atpF) in isolation and in reconstituted systems?

Assessing the functional activity of recombinant Thermotoga sp. ATP synthase subunit b (atpF) requires both isolated protein characterization and evaluation of its function within the ATP synthase complex:

Assays for Isolated atpF:

• Structural integrity assessment:

  • Circular dichroism (CD) to verify secondary structure content

  • Thermal shift assays to determine stability at different temperatures

  • Limited proteolysis to assess proper folding

• Binding assays:

  • Surface plasmon resonance (SPR) to measure interaction with other ATP synthase subunits

  • Microscale thermophoresis to quantify binding affinities

  • Pull-down assays to identify interaction partners

Functional Assays in Reconstituted Systems:

• Complementation assays: Adding recombinant atpF to depleted submitochondrial particles or bacterial membrane vesicles to restore ATP synthase activity, similar to experiments with factor B .

• Reconstitution in liposomes:

  • ATP synthesis activity measurement using luciferin/luciferase assay

  • Proton pumping assays using pH-sensitive fluorescent dyes

  • ATP hydrolysis activity using malachite green phosphate detection

• Single-molecule studies:

  • Measuring rotational steps in reconstituted ATP synthase complexes

  • Assessing the effect of atpF on coupling efficiency between F₀ and F₁ motors

Comparative Activity Analysis:

• Testing protein function at different temperatures (37-80°C) to assess thermostability

• Evaluating activity under different pH conditions

• Comparing activity with atpF from related Thermotoga species to identify species-specific functional differences

For valid results, it's essential to include appropriate controls, such as known inactive mutants or heat-denatured protein samples, to establish baseline measurements.

How can researchers design and implement genetic manipulation strategies to study Thermotoga sp. ATP synthase subunit b (atpF) function in vivo?

Genetic manipulation of Thermotoga species to study ATP synthase subunit b (atpF) presents unique challenges due to their extremophilic nature, but several approaches have proven successful:

Gene Disruption/Replacement Strategies:

• Homologous recombination: The approach successfully used for malK3 gene disruption in T. maritima can be adapted for atpF studies. This involves:

  • Designing homologous flanking regions around the atpF gene

  • Creating a disruption construct with a selectable marker

  • Transformation into naturally competent Thermotoga sp. strain RQ7

  • Selection of recombinants on appropriate media

• CRISPR-Cas9 system adaptation: Recently developed for some thermophiles, this could provide more precise genetic modifications.

Genetic Complementation Approaches:

• Gene repair by recombination: Similar to the strategy used to restore maltose catabolism in T. maritima malK3 mutants .

• Expression plasmids: Development of shuttle vectors that function in both E. coli and Thermotoga.

Expression Analysis Methods:

• RT-PCR: To quantify atpF expression under different conditions, as demonstrated in the analysis of CLF-related genes .

• Reporter gene fusions: Using thermostable reporters like certain luciferases.

• Protein tagging: With small epitope tags for immunodetection or fluorescent proteins engineered for thermostability.

Phenotypic Analysis:

• Growth curve measurements: Comparing wild-type and atpF-modified strains under various conditions.

• Bioenergetic parameters: Measuring cellular ATP/ADP ratios, membrane potential, and pH gradients.

• Metabolic product analysis: Quantifying hydrogen, lactate, and acetate production as performed in CLF studies .

The natural competence of Thermotoga sp. strain RQ7 makes it an excellent candidate for genetic studies of atpF function, potentially revealing how ATP synthase components contribute to extreme thermophily and metabolic versatility in these organisms.

How does the structure and function of ATP synthase subunit b differ between Thermotoga species and other extremophiles?

Comparative analysis of ATP synthase subunit b across different extremophiles reveals adaptations to diverse environmental challenges:

Structural Comparisons:

Functional Differences:

• Proton binding and translocation: The F₀ sector, including subunit b, shows specialized adaptations in different extremophiles to maintain proton motive force under extreme conditions. In Thermotoga, these adaptations enable function at high temperatures where membranes become more fluid and prone to proton leakage.

• Stator flexibility: The stator structure, which includes subunit b, exhibits different rigidity characteristics across extremophiles. In thermophiles like Thermotoga, it maintains appropriate rigidity despite thermal motion, while in psychrophiles it remains flexible enough at low temperatures.

• Regulatory mechanisms: Different extremophiles employ varied regulatory strategies for ATP synthase. The V-ATPase upregulation observed in certain Thermotoga species but not in T. maritima suggests species-specific regulatory mechanisms even within the same genus .

Research into these differences continues to provide insights into how similar protein architectures can be modified to function under dramatically different environmental conditions, offering valuable information for protein engineering and biotechnological applications.

What insights can be gained from comparing recombinant Thermotoga sp. ATP synthase subunit b (atpF) with the ATP phosphoribosyl transferase complex from the same organism?

Comparing ATP synthase subunit b (atpF) with the ATP phosphoribosyl transferase (ATP-PRTase) complex from Thermotoga maritima offers valuable insights into how this extremophile has evolved different energy-related enzyme systems:

Structural Organization Comparison:

• Oligomeric arrangement: While ATP synthase is a multi-subunit complex with the b subunit forming part of the stator, ATP-PRTase in T. maritima forms a distinct 220 kDa hetero-octameric complex with four catalytic (HisGS) and four regulatory (HisZ) subunits .

• Regulatory interfaces: ATP-PRTase has histidine binding sites at each of the four HisGS-HisZ interfaces, allowing allosteric regulation . In contrast, ATP synthase regulation involves conformational changes transmitted through multiple subunits including the b subunit.

Functional Comparisons:

• Metabolic roles: ATP synthase generates ATP using proton motive force, while ATP-PRTase catalyzes the first step of histidine biosynthesis, using ATP as a substrate . These complementary roles link energy production with biosynthesis.

• Regulatory mechanisms: ATP-PRTase is non-competitively inhibited by histidine through binding at subunit interfaces , whereas ATP synthase regulation is more complex, involving proton gradient sensing, nucleotide binding, and potentially subunit ε in bacteria .

Evolutionary Insights:

• Ancestral connections: The regulatory HisZ subunit of ATP-PRTase is distantly related to class II aminoacyl-tRNA synthetases, suggesting evolutionary links between amino acid biosynthesis and protein synthesis . ATP synthase subunits may have similar deep evolutionary connections to other energy-transducing systems.

• Adaptation strategies: Both enzyme systems demonstrate how Thermotoga has evolved protein complexes capable of functioning efficiently at high temperatures, but using different structural solutions.

This comparative analysis highlights how Thermotoga species have evolved distinct solutions for enzyme function and regulation at high temperatures across different metabolic pathways, providing insights into protein structure-function relationships in extremophiles.

How does the role of ATP synthase subunit b in Thermotoga sp. relate to the observed differences in hydrogen production and fermentation pathways among Thermotoga species?

The ATP synthase complex, including subunit b (atpF), plays a crucial role in energy metabolism that directly impacts hydrogen production and fermentation pathways in Thermotoga species. Recent research reveals significant species-specific differences:

Species-Specific Variations:

• Thermotoga neapolitana and T. sp. strain RQ7: These species perform capnophilic lactic fermentation (CLF) under CO₂ atmosphere, enabling simultaneous production of hydrogen and lactic acid. They show upregulation of V-ATPase, which couples ATP hydrolysis to proton transport across membranes .

• Thermotoga maritima: This species does not perform CLF and lacks V-ATPase. It produces lower hydrogen levels compared to T. neapolitana and T. sp. strain RQ7 under similar conditions .

Metabolic Implications:

• Proton gradient management: ATP synthase components, including subunit b, are central to maintaining the proton motive force required for energy conservation. In CLF-performing species, the membrane potential must support both ATP synthesis and the high demand for reducing equivalents needed for simultaneous hydrogen and lactic acid production .

• Enzyme coupling: The ATP synthase complex functionally interacts with other energy-transducing systems. In CLF-performing species, upregulated enzymes include PFOR, HYD, LDH, RNF, and NFN, which must coordinate with ATP synthase for efficient energy use .

Experimental Evidence:
Comparative analysis of fermentation products under N₂ versus CO₂ sparging revealed:

What are the potential applications of recombinant Thermotoga sp. ATP synthase subunit b (atpF) in synthetic biology and bioenergy systems?

Recombinant Thermotoga sp. ATP synthase subunit b (atpF) offers several promising applications in synthetic biology and bioenergy systems due to its thermostable properties and role in energy transduction:

Bioenergy Applications:

• Thermostable ATP production systems: Engineering synthetic ATP production modules using thermostable components from Thermotoga could create robust biocatalytic systems for ATP regeneration in high-temperature industrial processes.

• Enhanced hydrogen production: Understanding how ATP synthase components contribute to the CLF pathway could lead to engineered systems with improved hydrogen yields. The simultaneous production of hydrogen and lactic acid under CO₂ offers an economically attractive process for bioenergy production .

• CO₂ valorization: The ability of certain Thermotoga species to utilize CO₂ in metabolic processes involving ATP synthase components suggests potential applications in carbon capture and utilization technologies .

Synthetic Biology Platforms:

• Thermostable minimal cells: Incorporating thermostable ATP synthase components into minimal cell designs could create robust cellular platforms that function at elevated temperatures.

• Protein engineering templates: The structural features that confer thermostability to atpF could inform the design of other thermostable proteins for industrial applications.

• Metabolic circuit components: Thermotoga ATP synthase components could serve as reliable parts in synthetic metabolic circuits designed to function under extreme conditions.

Research Approaches:

• Hybrid ATP synthase engineering: Creating chimeric ATP synthases with subunits from different species to optimize performance under specific conditions.

• Integration with other extremophile components: Combining thermostable ATP synthase with components from other extremophiles to create multi-extremophilic systems.

• Directed evolution: Applying directed evolution to further enhance the performance of Thermotoga atpF for specific applications.

The study of Thermotoga sp. ATP synthase subunit b not only advances our understanding of extremophile biology but also provides valuable components for sustainable bioengineering applications in hydrogen production, carbon utilization, and thermostable biocatalysis.

What methodological advances would enable better structural and functional characterization of membrane proteins like ATP synthase subunit b from extremophiles?

Characterizing membrane proteins from extremophiles presents unique challenges that require innovative methodological approaches:

Advanced Structural Analysis Techniques:

• Cryo-electron microscopy (cryo-EM) adaptations: Developing specialized sample preparation methods for thermophilic membrane proteins that preserve native lipid interactions while allowing high-resolution imaging.

• Solid-state NMR innovations: Creating new pulse sequences and labeling strategies optimized for the unique properties of extremophile membrane proteins.

• X-ray free-electron laser (XFEL) applications: Using XFEL to obtain structural information from microcrystals of membrane proteins in lipidic environments at room temperature.

• Integrative structural biology approaches: Combining multiple techniques (cryo-EM, mass spectrometry, molecular dynamics, SAXS) to build comprehensive structural models of extremophile membrane protein complexes.

Functional Characterization Advances:

• High-temperature single-molecule techniques: Developing microscopy and spectroscopy methods that function reliably at elevated temperatures to study proteins in near-native conditions.

• Nanodiscs and lipid nanoparticle adaptations: Creating thermostable membrane mimetics that better replicate the native membrane environment of thermophilic proteins.

• Microfluidic platforms: Designing systems that can rapidly test protein function under various extreme conditions with minimal sample consumption.

• In silico prediction improvements: Developing better computational models for predicting membrane protein behavior under extreme conditions based on sequence information.

Expression and Purification Innovations:

• Cell-free expression systems: Engineering thermostable cell-free systems specifically for extremophile membrane protein production.

• Native source culturing advances: Improving cultivation techniques for extremophiles to obtain larger quantities of native membrane proteins.

• Detergent-free extraction methods: Developing novel approaches to isolate membrane proteins while preserving their native lipid environment.

These methodological advances would significantly enhance our ability to study ATP synthase subunit b and other membrane proteins from extremophiles, providing deeper insights into their unique adaptations and potential biotechnological applications.