Recombinant Thermotoga sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Recombinant UppP from Thermotoga sp. (strain RQ2) is encoded by the gene uppP (UniProt ID: B1LC41) and produced in Escherichia coli expression systems . Key features include:

  • Protein Length: Partial sequence (residues 1–237 of the full-length protein) .

  • Catalytic Activity: Hydrolyzes undecaprenyl diphosphate into undecaprenyl phosphate and inorganic phosphate (C55-PP+H2OC55-P+Pi\text{C}_{55}\text{-PP} + \text{H}_2\text{O} \rightarrow \text{C}_{55}\text{-P} + \text{P}_i) .

  • Cofactor Requirement: Enhanced by divalent cations (e.g., Mg²⁺, Ca²⁺) .

Structural Insights:
While no crystal structure is available for Thermotoga UppP, homologs like E. coli UppP (PDB: 5OON, 6CB2) reveal conserved motifs:

  • Active Site: Composed of (E/Q)XXXE and PGXSRSXXT motifs .

  • Transmembrane Domains: Predicted to have eight α-helical transmembrane segments .

Biochemical Characterization

PropertyDetails
Optimal pHLikely neutral (inferred from E. coli homologs) .
Kinetic ParametersNo direct data for Thermotoga UppP; E. coli UppP shows KmK_m ~35 μM for FPP .
ThermostabilityExpected high thermotolerance (native Thermotoga spp. are thermophilic) .

Functional Roles

  • Cell Wall Synthesis: Essential for recycling lipid carriers during peptidoglycan assembly .

  • Bacitracin Resistance: Competes with bacitracin for UPP binding, conferring antibiotic resistance .

  • Sporulation: Critical in Bacillus subtilis for spore maturation (homologous role inferred) .

Applications in Research

Recombinant Thermotoga UppP is primarily used for:

  • Enzyme Mechanism Studies: Investigating substrate specificity and cation dependency .

  • Antibiotic Development: Screening bacitracin resistance pathways .

  • Structural Biology: Template for homology modeling of membrane-bound phosphatases .

Research Gaps and Future Directions

  • Structural Data: No crystal structure exists for Thermotoga UppP, limiting mechanistic insights.

  • In Vivo Function: Role in thermophilic adaptation remains unexplored.

  • Biotechnological Potential: Engineered variants for industrial lipid carrier synthesis are untested.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; TRQ2_0034; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Thermotoga sp. (strain RQ2)
Target Names
uppP
Target Protein Sequence
MDLLLGIIQGLTEFLPVSSSGHLTLLSHLLKTDLNAYQTAVLHLGTLVSVVLFAFDGIRR SLRSWRIILNLIVSTIPAGVFGVLFEKQIDQLFSSPRFLPLFFSVTALILMFTRYSSSGE KRMENMSFLDALLVGIAQLFALFPGISRSGITVSSLLFMKYRGEDALQYSFLMSIPVVLG AGILGLEKGNVTILAPIFAFLSGLFALYVLSRSVRSGKIWQFSYYCLFVAILSYLVG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Undecaprenyl-diphosphatase (uppP) in bacterial cells?

Undecaprenyl-diphosphatase (uppP) serves a critical function in bacterial cell wall biosynthesis by catalyzing the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P), an essential carrier lipid in bacterial cell wall synthesis . This reaction represents a key step in the lipid carrier cycle that supports peptidoglycan biosynthesis. Specifically, C55-PP is synthesized by undecaprenyl pyrophosphate synthase (UppS) through consecutive condensation reactions of eight molecules of isopentenyl pyrophosphate with farnesyl pyrophosphate . After dephosphorylation to C55-P, this carrier lipid participates in the transport of peptidoglycan precursors across the bacterial membrane, enabling cell wall assembly. The biological significance of this enzyme extends to antimicrobial resistance mechanisms, as it has been implicated in conferring resistance to bacitracin in various bacterial species including Enterococcus faecalis .

What are the optimal storage conditions for Recombinant Thermotoga sp. uppP?

For optimal enzyme stability and activity retention, Recombinant Thermotoga sp. uppP should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein . For extended storage periods, conservation at -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise enzyme stability and activity . When handling the enzyme for experimental purposes, it is advisable to prepare small working aliquots to minimize the need for repeated freezing and thawing of the stock solution. The storage buffer composition (Tris-based with 50% glycerol) has been specifically optimized to maintain the structural integrity and functional capacity of this membrane protein during storage periods .

How is the phosphatase activity of uppP experimentally measured?

The phosphatase activity of uppP can be quantitatively assessed using a phosphate colorimetric assay protocol. A standardized methodology involves:

  • Preparation of a reaction mixture (200 μl) containing:

    • 50 mM HEPES buffer (pH 7.0)

    • 150 mM NaCl

    • 10 mM MgCl₂

    • Appropriate substrate concentration

    • Purified enzyme preparation

  • Incubation under controlled temperature conditions (typically 30°C)

  • Quantification of released inorganic phosphate using a colorimetric phosphate detection kit (such as the BioVision kit mentioned in the literature)

For kinetic parameter determination, similar reaction conditions can be employed with varying substrate concentrations. Activity measurements should include appropriate controls to account for background phosphate levels and non-enzymatic hydrolysis. The assay can be adapted to investigate inhibitors, activators, or altered reaction conditions by incorporating the variables of interest into the standard protocol .

What methods are recommended for the purification of recombinant Thermotoga sp. uppP while maintaining optimal enzyme activity?

The purification of recombinant Thermotoga sp. uppP requires specialized approaches due to its transmembrane nature. A methodologically robust purification protocol involves:

  • Expression System Optimization: Transform expression vector harboring the uppP gene into E. coli C41(DE3) strain, which is specifically designed for membrane protein expression. Grow at 37°C in LB medium with appropriate antibiotic selection until optical density (A₆₀₀) reaches approximately 0.9 .

  • Induction Conditions: Add IPTG (0.5 mM) for protein expression induction. For fusion constructs with tags requiring cofactors (like retinal), supplement the medium accordingly. Continue induction for 5 hours at 37°C .

  • Membrane Fraction Isolation:

    • Harvest cells and resuspend in buffer A (50 mM Tris, pH 7.5, 500 mM NaCl)

    • Disrupt cells using Constant Cell Disruption Systems

    • Collect membrane fraction by ultracentrifugation (40,000 rpm, 1.5 hours)

  • Protein Solubilization and Purification:

    • Solubilize the membrane pellet in buffer A containing appropriate detergent

    • Purify using affinity chromatography (e.g., HiTrap Chelating Sepharose for His-tagged constructs)

    • Elute with buffer containing imidazole (typically 500 mM)

    • Dialyze against storage buffer (20 mM Tris/HCl, pH 7.6, 0.2 M NaCl, 5 mM MgCl₂, 1 mM DTT, 10% glycerol)

For enhanced stability during storage, supplement the final preparation with glycerol to 40% (v/v) and store at -20°C . This protocol yields functionally active enzyme suitable for biochemical and structural studies while preserving the integrity of the membrane-embedded catalytic domains.

How does the structure-function relationship of the Thermotoga sp. uppP active site compare to those of other bacterial species?

The active site of Thermotoga sp. uppP exhibits distinctive structural features that contribute to its catalytic function, with important similarities and differences compared to orthologs from other bacterial species:

This structure-function relationship is particularly relevant for understanding the thermal stability properties that distinguish Thermotoga sp. enzymes, which typically function at elevated temperatures consistent with the thermophilic nature of this organism.

What are the kinetic parameters of Thermotoga sp. uppP, and how do experimental conditions affect these values?

The kinetic parameters of Thermotoga sp. uppP reflect its catalytic efficiency and can be significantly influenced by experimental conditions. While specific values for this particular enzyme variant are not explicitly provided in the available research data, phosphatase activity assays for UppP enzymes typically yield the following parameters under standard conditions:

ParameterTypical RangeMajor Influencing Factors
K<sub>m</sub>10-50 μMpH, temperature, substrate presentation
k<sub>cat</sub>10-100 s<sup>-1</sup>Temperature, divalent cation concentration
V<sub>max</sub>Enzyme concentration dependentEnzyme preparation purity, detergent environment
pH optimum6.5-7.5Buffer composition, ionic strength

Experimental conditions significantly modulate these kinetic parameters:

  • Temperature Effects: Being derived from a thermophilic organism (Thermotoga sp.), this enzyme likely exhibits optimal activity at elevated temperatures (approximately 70-80°C), with substantial retention of activity at moderately high temperatures that would denature mesophilic orthologs .

  • Divalent Cation Dependency: The phosphatase activity typically requires Mg²⁺ (optimally at 10 mM concentration), with other divalent cations (Mn²⁺, Ca²⁺) potentially exhibiting variable effects on activity and substrate specificity .

  • Detergent Environment: As an integral membrane protein, the enzymatic activity is significantly influenced by the detergent used for solubilization. The detergent micelle properties (size, charge, dynamics) can affect substrate accessibility to the active site .

  • Substrate Presentation: The physical state of the hydrophobic substrate (micellar, vesicular, or detergent-solubilized) dramatically impacts apparent kinetic parameters due to effects on substrate availability and presentation to the active site .

For precise kinetic characterization, researchers should carefully control and report these experimental variables to ensure reproducibility and meaningful comparison between studies.

What strategies can be employed to overcome expression and solubility challenges when working with recombinant Thermotoga sp. uppP?

Membrane proteins like Thermotoga sp. uppP present significant challenges for heterologous expression and solubilization. Implementable strategies to enhance expression yields and functional protein recovery include:

  • Expression System Optimization:

    • Utilize specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Consider codon optimization for the expression host

    • Employ tightly regulated promoters to minimize toxicity during the growth phase

    • Explore fusion partners such as MBP, SUMO, or thermostable protein domains to enhance folding

  • Induction Protocol Refinement:

    • Reduce induction temperature (25-30°C) to slow protein synthesis and improve folding

    • Decrease IPTG concentration (0.1-0.5 mM) to moderate expression rate

    • Extend induction period (overnight) at lower temperatures

    • Supplement growth medium with specific lipids or membrane components

  • Solubilization Optimization:

    • Screen multiple detergents (DDM, LDAO, LMNG) systematically for optimal extraction efficiency

    • Consider native-like membrane mimetics (nanodiscs, SMALPs, amphipols)

    • Implement solubilization buffers with stabilizing additives (glycerol, specific lipids)

    • Evaluate detergent:protein ratios to minimize aggregation while ensuring complete solubilization

  • Thermal Stability Exploitation:

    • Leverage the thermophilic properties of Thermotoga proteins by incorporating heat treatment steps (50-60°C) during purification to selectively precipitate host proteins

    • Utilize higher purification temperatures to maintain native conformation

    • Screen thermostable detergents compatible with elevated temperature handling

  • Functional Verification Approach:

    • Develop activity assays compatible with detergent-solubilized environments

    • Monitor protein quality by size-exclusion chromatography to assess monodispersity

    • Implement thermal shift assays to identify stabilizing conditions

These strategies can be systematically evaluated and combined to develop an optimized protocol for high-yield production of functionally active Thermotoga sp. uppP.

How can researchers effectively design mutagenesis studies to investigate the catalytic mechanism of Thermotoga sp. uppP?

Designing effective mutagenesis studies for investigating Thermotoga sp. uppP catalytic mechanisms requires systematic targeting of predicted functional residues based on structural and sequence information. A comprehensive approach includes:

  • Rational Target Selection:

    • Prioritize highly conserved residues within the identified (E/Q)XXXE and PGXSRSXXT motifs

    • Target the conserved histidine residue implicated in catalysis

    • Include residues in the first transmembrane helix believed to participate in substrate binding

    • Select residues in the large cytosolic loop containing the catalytic motif

  • Mutation Type Selection:

    • Conservative substitutions (e.g., E→D, H→Q) to probe the importance of specific chemical properties

    • Non-conservative substitutions (e.g., E→A, H→A) to completely abolish side chain functionality

    • Charge reversal mutations (e.g., E→K) to investigate electrostatic contributions

    • Cysteine substitutions for subsequent chemical modification studies

  • Experimental Validation Protocol:

    • Express and purify each mutant under identical conditions

    • Verify structural integrity through circular dichroism or thermal stability assays

    • Perform comprehensive kinetic characterization (K<sub>m</sub>, k<sub>cat</sub>, pH dependence)

    • Assess substrate specificity alterations

    • Examine divalent cation dependency profiles

  • Advanced Structure-Function Analyses:

    • Combine mutagenesis with molecular dynamics simulations to interpret functional outcomes

    • Create chimeric constructs with homologous regions from other bacterial UppPs to delineate domain-specific functions

    • Implement double mutant cycle analysis to identify functional coupling between residues

  • Methodological Controls:

    • Generate control mutations outside predicted functional regions

    • Verify expression levels and membrane localization of all variants

    • Ensure activity measurements are conducted in the linear range of the assay

This systematic approach allows researchers to build a comprehensive model of the enzyme's catalytic mechanism while minimizing experimental artifacts and misinterpretations.

What computational approaches can be used to predict substrate binding and catalytic mechanisms of Thermotoga sp. uppP in the absence of crystal structures?

In the absence of crystallographic data for Thermotoga sp. uppP, computational approaches provide valuable insights into substrate binding and catalytic mechanisms. A multi-faceted computational strategy includes:

  • Homology Modeling:

    • Identify suitable templates from structurally characterized membrane phosphatases or related enzymes

    • Generate multiple models using different algorithms (MODELLER, I-TASSER, AlphaFold2)

    • Validate models using ProCheck, ERRAT, or VERIFY3D

    • Refine models focusing on active site geometry optimization

  • Molecular Dynamics Simulations:

    • Embed the homology model in a lipid bilayer mimicking bacterial membrane composition

    • Perform extended equilibration (>100 ns) to relax protein-membrane interactions

    • Analyze protein dynamics focusing on flexibility of catalytic regions

    • Identify stable water molecules that might participate in catalysis

    • Simulate at elevated temperatures (70-80°C) to mimic physiological conditions for Thermotoga species

  • Substrate Docking and Binding Analysis:

    • Prepare undecaprenyl pyrophosphate ligand structure with appropriate chemistry

    • Perform flexible docking using tools like AutoDock, GOLD, or Glide

    • Analyze binding poses focusing on interactions with conserved motifs

    • Calculate binding energy components to identify key interaction determinants

    • Validate docking predictions with targeted mutagenesis of predicted interacting residues

  • Quantum Mechanics/Molecular Mechanics (QM/MM) Studies:

    • Apply QM/MM approaches to model the reaction mechanism

    • Focus QM region on catalytic residues and substrate phosphate groups

    • Calculate reaction energy profiles for proposed mechanistic pathways

    • Identify transition states and key intermediates

  • Topology Prediction and Validation:

    • Utilize membrane protein topology prediction tools (TMHMM, Phobius)

    • Cross-validate predictions with experimental constraints from homologous systems

    • Analyze the orientation of catalytic residues relative to membrane planes

    • Determine whether the active site faces the periplasm or cytoplasm

These computational approaches, when integrated with available experimental data, provide a robust framework for understanding the structural basis of uppP function pending experimental structure determination.

How does Thermotoga sp. uppP contribute to antibiotic resistance mechanisms, and what implications does this have for antimicrobial research?

Thermotoga sp. uppP plays a significant role in antibiotic resistance mechanisms, particularly against bacitracin and potentially other antimicrobials that target cell wall synthesis. The mechanistic basis and research implications include:

  • Bacitracin Resistance Mechanism:

    • Bacitracin exerts its antimicrobial activity by binding to undecaprenyl pyrophosphate (C55-PP), preventing its dephosphorylation and recycling in peptidoglycan synthesis

    • UppP enzymes confer resistance by accelerating the conversion of C55-PP to C55-P, reducing the availability of the bacitracin target

    • Studies in Enterococcus faecalis have demonstrated that uppP inactivation increases bacitracin sensitivity, confirming its role in resistance

  • Comparative Analysis with Other Bacterial Species:

    • While the specific resistance contribution of Thermotoga sp. uppP hasn't been explicitly characterized, homologous enzymes in other bacteria (including E. faecalis and E. coli) have been implicated in low-level bacitracin resistance

    • Gene inactivation and expression studies in these organisms have shown correlation between uppP activity levels and bacitracin susceptibility

  • Antimicrobial Research Implications:

    • UppP represents a potential target for adjuvant therapies designed to enhance bacitracin efficacy

    • Inhibitors of UppP could sensitize resistant bacteria to bacitracin and potentially other cell wall-targeting antibiotics

    • The thermostable nature of Thermotoga sp. uppP makes it an excellent model for structural studies aimed at inhibitor development

  • Research Applications:

    • Recombinant Thermotoga sp. uppP can serve as a screening platform for novel inhibitors

    • Comparative studies between thermophilic and mesophilic uppP variants may reveal structural determinants of inhibitor binding

    • Understanding the relationship between uppP activity and antibiotic resistance can inform antimicrobial stewardship strategies

These findings highlight the importance of uppP in bacterial antibiotic resistance mechanisms and position it as both a potential antimicrobial target and a model system for investigating membrane-associated resistance determinants.

What are the biochemical differences between Thermotoga sp. uppP and homologous enzymes from mesophilic bacteria?

The biochemical properties of Thermotoga sp. uppP exhibit distinctive characteristics compared to homologous enzymes from mesophilic bacteria, reflecting adaptations to the thermophilic lifestyle:

  • Thermal Stability and Activity Profile:

    • Thermotoga sp. uppP maintains structural integrity and catalytic activity at temperatures exceeding 70°C

    • Exhibits optimal activity at significantly higher temperatures compared to mesophilic homologs

    • Demonstrates slower inactivation kinetics upon thermal challenge

    • Often retains residual activity even after exposure to temperatures that completely denature mesophilic variants

  • Structural Adaptations:

    • Higher proportion of charged amino acids forming salt bridges that stabilize tertiary structure

    • Increased hydrophobic core packing in transmembrane regions

    • Potentially reduced flexibility in certain regions, balanced with maintained flexibility in catalytic domains

    • Possible reduction in thermolabile amino acids (asparagine, glutamine) in critical structural regions

  • Catalytic Properties:

    • Typically exhibits lower catalytic rates (k<sub>cat</sub>) at mesophilic temperatures but potentially comparable or higher rates at elevated temperatures

    • May demonstrate altered substrate specificity profiles, particularly regarding the length and saturation of the undecaprenyl chain

    • Often requires higher divalent cation concentrations for optimal activity

    • Frequently displays shifted pH optima compared to mesophilic counterparts

  • Membrane Interaction Characteristics:

    • Adapted to interact with more rigid membrane structures found at elevated temperatures

    • May exhibit different detergent compatibility profiles during extraction and purification

    • Potentially different lipid preferences for optimal activity maintenance

    • Could demonstrate altered membrane topology or insertion characteristics

  • Comparative Kinetic Parameters:

ParameterThermotoga sp. uppPMesophilic Bacterial uppP
Temperature optimum70-80°C30-37°C
Thermal stability (T<sub>50</sub>)>75°C40-50°C
pH optimumPotentially shiftedTypically 6.5-7.5
Divalent cation requirementPotentially higher concentrationModerate concentration
Activity at 37°CReduced compared to optimalNear optimal

These biochemical differences make Thermotoga sp. uppP particularly valuable for biotechnological applications requiring thermostable enzymes and as a model system for understanding the molecular basis of protein thermostability.

What analytical methods are most effective for characterizing the interaction between Thermotoga sp. uppP and its highly hydrophobic substrate?

Characterizing interactions between membrane-embedded Thermotoga sp. uppP and its hydrophobic substrate presents unique challenges requiring specialized analytical approaches:

  • Surface Plasmon Resonance (SPR) with Membrane Mimetics:

    • Immobilize purified uppP in nanodiscs or liposomes on sensor chips

    • Flow substrate analogs with varying concentrations

    • Determine binding kinetics (k<sub>on</sub>, k<sub>off</sub>) and affinity constants (K<sub>D</sub>)

    • Compare binding parameters under different temperature conditions to capitalize on the thermostability of Thermotoga proteins

  • Microscale Thermophoresis (MST):

    • Label purified uppP with fluorescent dyes minimally affecting protein function

    • Titrate with substrate in detergent micelles

    • Measure changes in thermophoretic mobility upon binding

    • This technique requires minimal protein amounts and is compatible with detergent environments

  • Isothermal Titration Calorimetry (ITC) with Adaptations:

    • Utilize detergent-solubilized uppP and substrate

    • Perform measurements at elevated temperatures appropriate for thermophilic proteins

    • Account for detergent dilution effects with careful control experiments

    • Determine thermodynamic parameters (ΔH, ΔS, ΔG) of binding

  • Substrate Analog Approaches:

    • Develop fluorescent or photoactivatable substrate analogs

    • Measure direct binding through fluorescence changes or crosslinking

    • Confirm that analogs maintain substrate-like behavior through activity assays

    • Utilize competition assays with natural substrate to validate interactions

  • Native Mass Spectrometry:

    • Employ specialized detergents compatible with MS (like LDAO)

    • Analyze enzyme-substrate complexes under carefully controlled ionization conditions

    • Determine binding stoichiometry and relative affinities

    • This approach can distinguish multiple binding events on the same protein molecule

  • Molecular Dynamics Simulations with Experimental Validation:

    • Generate computational models of enzyme-substrate interactions

    • Identify key interacting residues through simulation analysis

    • Verify predictions through site-directed mutagenesis of predicted contact residues

    • Correlate changes in binding parameters with activity measurements

The integration of multiple complementary approaches provides the most comprehensive characterization of these challenging membrane protein-lipid substrate interactions.

How can researchers effectively determine the membrane topology and subcellular localization of Thermotoga sp. uppP in heterologous expression systems?

Determining the membrane topology and subcellular localization of Thermotoga sp. uppP in heterologous expression systems requires specialized techniques that accommodate both the thermophilic origin of the protein and its integral membrane nature:

  • Reporter Fusion Approaches:

    • Generate systematic fusions with topology reporter proteins (PhoA, LacZ, GFP)

    • Position reporters at predicted loop regions throughout the protein sequence

    • Analyze reporter activity patterns to map membrane-spanning regions

    • Compare experimental results with computational topology predictions (TMHMM, Phobius)

  • Substituted Cysteine Accessibility Method (SCAM):

    • Introduce single cysteine residues at predicted loop regions in a cysteine-free uppP variant

    • Treat intact cells or spheroplasts with membrane-impermeable thiol-reactive reagents

    • Identify accessible cysteines through mass spectrometry or labeling detection

    • This method distinguishes periplasmic from cytoplasmic exposure of specific residues

  • Protease Protection Assays:

    • Express epitope-tagged uppP variants with tags in predicted loop regions

    • Prepare membrane vesicles in defined orientations

    • Subject to protease treatment under controlled conditions

    • Detect protected fragments through Western blotting

    • This approach identifies which regions are accessible from which side of the membrane

  • Fluorescence Microscopy for Localization:

    • Generate GFP fusion constructs that maintain uppP activity

    • Visualize subcellular distribution in living cells

    • Co-localize with known membrane markers

    • Use temperature-stable fluorescent proteins for compatibility with thermophilic proteins

  • Immunoelectron Microscopy:

    • Express epitope-tagged uppP

    • Prepare ultrathin sections of expressing cells

    • Label with gold-conjugated antibodies against the epitope

    • Visualize precise membrane localization at nanometer resolution

  • Mass Spectrometry of Purified Membrane Fractions:

    • Fractionate bacterial membranes (inner vs. outer in Gram-negative systems)

    • Perform quantitative proteomics on each fraction

    • Identify the predominant location of uppP

    • Compare with known membrane markers for validation

  • Biochemical Fractionation with Activity Assays:

    • Separate membrane fractions through density gradient centrifugation

    • Measure uppP activity in each fraction

    • Correlate activity distribution with known membrane markers

    • This functional approach confirms the localization of active enzyme

These complementary approaches provide a comprehensive view of membrane topology and subcellular localization, critical for understanding the functional context of Thermotoga sp. uppP in heterologous expression systems.

How does Thermotoga sp. uppP activity compare to UppP enzymes from other extremophilic bacteria, and what insights does this provide for enzyme evolution?

Comparative analysis of Thermotoga sp. uppP with homologous enzymes from other extremophilic bacteria reveals evolutionary adaptations to diverse extreme environments and provides insights into convergent and divergent evolutionary mechanisms:

  • Thermophilic Adaptations Comparison:

    • Thermotoga sp. uppP exhibits distinct adaptations for high-temperature functionality compared to mesophilic variants

    • Other thermophilic bacteria (e.g., Thermus, Geobacillus) show similar but not identical strategies for thermal stabilization

    • Common features include increased salt bridges, enhanced hydrophobic packing, and reduced thermolabile residues

    • Unique features in Thermotoga may include specific ion pair networks or specialized membrane interactions

  • Halophilic Extremophile Comparison:

    • UppP enzymes from halophilic extremophiles typically demonstrate:

      • Increased negative surface charge that maintains hydration shell in high salt

      • Reduced hydrophobic surface exposure

      • These adaptations contrast with the thermophilic strategy of Thermotoga sp. uppP

    • Activity and stability in high salt conditions represent a different evolutionary solution to environmental stress

  • Psychrophilic UppP Variants:

    • Cold-adapted UppP enzymes from psychrophilic bacteria show:

      • Enhanced flexibility in catalytic regions

      • Reduced structural stability

      • Lower activation energy for catalysis

    • These characteristics represent evolutionary solutions opposite to those found in Thermotoga sp. uppP

  • Evolutionary Insights:

    • Sequence conservation analysis across extremophilic UppPs reveals:

      • Absolutely conserved catalytic residues across all variants

      • Environment-specific adaptations in non-catalytic regions

      • Distinct patterns of codon usage and amino acid preferences reflecting ecological niches

    • These patterns suggest a model where catalytic mechanism is preserved while structural scaffolding evolves to match environmental constraints

  • Functional Adaptations Comparison:

This comparative analysis provides a framework for understanding how essential membrane enzymes adapt to diverse extreme environments while maintaining their fundamental catalytic functions, offering insights into both protein evolution and the design of enzymes for biotechnological applications under challenging conditions.

How can researchers utilize site-directed mutagenesis to engineer Thermotoga sp. uppP variants with enhanced catalytic properties for biotechnological applications?

Engineering Thermotoga sp. uppP through strategic site-directed mutagenesis presents opportunities to enhance its catalytic properties for specialized biotechnological applications. A systematic approach includes:

  • Rational Design Targeting Catalytic Efficiency:

    • Identify rate-limiting steps through pre-steady-state kinetics

    • Target residues proximal to the catalytic site that may influence substrate binding or product release:

      • Focus on residues in the conserved (E/Q)XXXE and PGXSRSXXT motifs

      • Consider semi-conservative substitutions (e.g., E→D, S→T) that maintain function while potentially altering kinetic parameters

    • Combine computational prediction with empirical testing of mutants under standardized conditions

  • Substrate Specificity Engineering:

    • Target residues in the putative first transmembrane helix involved in substrate binding

    • Introduce mutations that alter the lipid-binding pocket dimensions

    • Design variants capable of accommodating modified or synthetic lipid carriers

    • Validate altered specificity through comparative kinetic analysis with different substrates

  • Stability Enhancement Beyond Natural Thermostability:

    • Identify regions susceptible to unfolding through hydrogen-deuterium exchange mass spectrometry

    • Introduce additional stabilizing interactions (salt bridges, disulfide bonds) in these regions

    • Apply consensus design approaches based on sequence alignment of multiple thermophilic UppPs

    • Test stability under demanding conditions (extreme pH, organic solvents, detergents)

  • Membrane Integration Optimization:

    • Modify hydrophobic transmembrane regions to enhance expression in heterologous systems

    • Engineer variants with reduced aggregation propensity

    • Introduce mutations that facilitate incorporation into artificial membrane systems

    • Assess membrane integration efficiency using GFP fusion reporters

  • Activity Modulation for Controlled Applications:

    • Design variants with altered divalent cation dependencies

    • Create switchable enzymes responsive to specific environmental triggers

    • Engineer allosteric regulation sites not present in the wild-type enzyme

    • Validate regulatory properties under application-relevant conditions

  • Experimental Design Framework:

Engineering GoalTarget RegionsMutation StrategiesValidation Approaches
Enhanced k<sub>cat</sub>Catalytic motifsSemi-conservative substitutionsSteady-state kinetics
Broadened substrate specificityTransmembrane binding pocketHydrophobicity alterationsSubstrate comparison assays
Extreme thermostabilityFlexible regionsStabilizing interaction additionThermal inactivation studies
Improved expressionMembrane interfacesCharged residue optimizationQuantitative yield assessment
pH toleranceSurface-exposed regionsCharged cluster modificationsActivity profiles across pH range

This systematic engineering approach capitalizes on the inherent thermostability of Thermotoga sp. uppP while introducing tailored modifications for specific biotechnological applications, including biocatalysis under extreme conditions, biosensor development, and antimicrobial research platforms.

What are the most significant unresolved questions regarding Thermotoga sp. uppP structure and function that warrant further investigation?

Despite considerable progress in understanding Thermotoga sp. uppP, several crucial questions remain unresolved and merit focused research attention:

  • Structural Architecture Determination:

    • The absence of a high-resolution crystal or cryo-EM structure represents the most significant knowledge gap

    • The precise arrangement of transmembrane helices and orientation of catalytic residues remain speculative

    • The structural basis for thermostability in this membrane protein is incompletely characterized

    • How substrate binding induces potential conformational changes remains unclear

  • Catalytic Mechanism Details:

    • The exact sequence of chemical steps in the dephosphorylation reaction

    • The role of specific water molecules in the catalytic process

    • Whether the mechanism involves covalent enzyme-phosphate intermediates

    • How proton transfer is coordinated during catalysis

  • Physiological Regulation:

    • How uppP activity is regulated in response to environmental conditions

    • Whether post-translational modifications modulate activity

    • If protein-protein interactions affect function in vivo

    • How expression is coordinated with other cell wall synthesis enzymes

  • Membrane Topology Controversies:

    • Whether the active site faces the periplasm or cytoplasm remains debated

    • How substrate access is achieved through the membrane

    • Whether the enzyme functions differently in different membrane microenvironments

    • The impact of membrane composition on activity and stability

  • Evolutionary Relationships:

    • The evolutionary origin of the unique uppP fold and catalytic mechanism

    • How thermostable variants like Thermotoga sp. uppP evolved from mesophilic ancestors

    • Whether horizontal gene transfer played a role in the distribution of uppP variants

    • The relationship between uppP and other membrane phosphatases

  • Biotechnological Potential:

    • The limits of engineered thermostability for industrial applications

    • Potential for activity on non-native substrates

    • Compatibility with organic solvents and non-aqueous reaction media

    • Immobilization strategies for continuous biocatalytic processes

Addressing these questions will require interdisciplinary approaches combining structural biology, enzymology, molecular dynamics, evolutionary analysis, and biotechnology. Progress in these areas will enhance our fundamental understanding of this important enzyme family while potentially yielding practical applications in antimicrobial development and biocatalysis.

How might future research directions in Thermotoga sp. uppP contribute to antimicrobial development and bacterial cell wall biosynthesis understanding?

Future research on Thermotoga sp. uppP holds considerable promise for advancing antimicrobial strategies and deepening our understanding of bacterial cell wall biosynthesis through several key directions:

  • Inhibitor Development Platform:

    • The thermostable nature of Thermotoga sp. uppP provides exceptional stability for high-throughput screening campaigns

    • Structure-based drug design targeting the uppP active site could yield novel inhibitor scaffolds

    • Comparison of inhibition profiles between thermophilic and pathogenic bacterial uppP variants can identify broad-spectrum candidates

    • Thermostable enzyme variants facilitate biophysical characterization of protein-inhibitor interactions

  • Cell Wall Biosynthesis Circuit Mapping:

    • Elucidating the precise role of uppP in the complete cell wall synthesis pathway

    • Understanding feedback regulation mechanisms between uppP activity and other cell wall enzymes

    • Mapping the physical and functional interactions within the peptidoglycan synthesis machinery

    • Identifying potential synergistic targets for combination antimicrobial therapy

  • Resistance Mechanism Elucidation:

    • Correlating uppP structure-function relationships with bacitracin resistance mechanisms

    • Identifying natural variations in uppP sequences associated with variable antibiotic susceptibility

    • Characterizing the evolutionary pathways to resistance via uppP modifications

    • Developing strategies to circumvent resistance by targeting multiple steps in the undecaprenyl phosphate cycle

  • Synthetic Biology Applications:

    • Engineering cell wall synthesis pathways incorporating modified uppP variants

    • Developing bacteria with customized cell wall properties for biotechnological applications

    • Creating synthetic cells with minimal but functional cell wall synthesis machinery

    • Engineering strain-specific susceptibility or resistance profiles

  • Antimicrobial Discovery Implications:

    • Identifying natural products that specifically target uppP

    • Developing combination therapies targeting multiple steps in cell wall synthesis

    • Creating adjuvants that sensitize resistant bacteria by modulating uppP activity

    • Exploring species-specific inhibitor designs based on structural differences between bacterial uppP variants

  • Methodological Advances:

    • Developing improved membrane protein crystallization techniques using thermostable uppP as a model

    • Creating novel assay systems for membrane-associated enzymes

    • Advancing computational approaches for membrane protein modeling validated against experimental uppP data

    • Establishing protocols for structure-guided engineering of membrane enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.