Recombinant Thermus thermophilus Magnesium transporter mgtE (TTHA1060)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Thermus thermophilus Magnesium transporter MgtE (TTHA1060) is a bacterial Mg²⁺ channel critical for maintaining intracellular Mg²⁺ homeostasis. Its full-length sequence (1–450 amino acids) includes a cytosolic CBS domain and a transmembrane domain, enabling Mg²⁺ transport through conformational changes regulated by ATP and Mg²⁺ levels . This recombinant protein, expressed in E. coli with an N-terminal His tag, serves as a model for studying Mg²⁺ transport mechanisms and ATP-dependent regulation .

Crystal structures of TTHA1060 reveal distinct conformations:

StateSpace GroupResolutionUnit Cell Parameters (Å)Asymmetric Unit
Mg²⁺-boundP6 5222.3 Åa = b = 57.7, c = 317.61 molecule
Mg²⁺-freeP2 12 12 13.5 Åa = 77.0, b = 100.3, c = 100.32 molecules
Cryo-EM (Mg²⁺-free)3.9 ÅPore-open state

Sources: Native crystals (Mg²⁺-bound: P6 522; Mg²⁺-free: P2 12 12 1) ; Cryo-EM (pore-open state) .

Mg²⁺ Transport and ATP Regulation

  • Mg²⁺-Dependent Gating: Binding of Mg²⁺ to the cytosolic domain induces a closed state, preventing influx. ATP binds to the CBS domain, enhancing Mg²⁺ affinity and enabling sensing within physiological concentrations (0.1–5 mM) .

  • ATP Modulation: ATP dissociation triggers Mg²⁺ influx, upregulating transport at both high and low Mg²⁺ levels .

ConditionMg²⁺ AffinityChannel StateRole of ATP
High Mg²⁺LowClosedATP binding stabilizes closed state
Low Mg²⁺HighOpenATP dissociation activates influx

Selectivity and Kinetics

  • Selectivity: The pore’s narrow selectivity filter (YGMNFxxMPEL motif) allows Mg²⁺ passage while excluding Ca²⁺ and Na⁺ .

  • Kinetics: Mg²⁺ transport is ATP-dependent, with Kₘ values aligning with bacterial Mg²⁺ requirements .

Recombinant Expression

ParameterSpecification
Host OrganismE. coli (C41(DE3) or BL21(DE3))
TagN-terminal His tag (6xHis)
Purity>85–90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stability

Challenges and Solutions

  • Crystallization: Native crystals require phospholipids (PL) to improve reproducibility. SeMet-substituted crystals (space group C222 1) enabled phase determination .

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting at -20°C/-80°C is recommended .

Applications in Research

ApplicationMethodologyKey Findings
Structural BiologyX-ray crystallography, Cryo-EMMg²⁺-dependent CBS domain conformational changes .
Functional AssaysElectrophysiology, ATP-bindingATP enhances Mg²⁺ affinity; pore opening at glycine kinks .
Mg²⁺ HomeostasisIn vivo models (e.g., S. typhimurium)MgtE orthologs regulate Mg²⁺ influx during stress .

Mg²⁺ and ATP Cross-Talk

  • CBS Domain: Mg²⁺ binding induces a closed conformation, while ATP binding stabilizes this state. ATP hydrolysis relieves inhibition, enabling Mg²⁺ influx .

  • Pore Dynamics: In Mg²⁺-free conditions, the transmembrane domain adopts a pore-open state, allowing ion passage .

Evolutionary Conservation

  • Eukaryotic Homologs: Human SLC41 proteins share the selectivity pore motif but lack CBS domains, suggesting divergent regulatory mechanisms .

Biochemical Properties

PropertyValue
Molecular Weight~50 kDa (full-length)
SolubilityRequires detergents (e.g., DDM)
Thermal StabilityOptimized for T. thermophilus (65°C growth) .

Future Directions

  1. Thermal Adaptation: Investigate how T. thermophilus MgtE maintains function at extreme temperatures .

  2. Polyamine Interactions: Explore modulation by polyamines (e.g., caldohexamine) to enhance activity at high temperatures .

  3. Eukaryotic Counterparts: Compare with human TRPM6/7 channels to elucidate Mg²⁺-kinase coupling mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
TTHA1060; Magnesium transporter MgtE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Target Names
TTHA1060
Target Protein Sequence
MEEKLAVSLQEALQEGDTRALREVLEEIHPQDLLALWDELKGEHRYVVLTLLPKAKAAEV LSHLSPEEQAEYLKTLPPWRLREILEELSLDDLADALQAVRKEDPAYFQRLKDLLDPRTR AEVEALARYEEDEAGGLMTPEYVAVREGMTVEEVLRFLRRAAPDAETIYYIYVVDEKGRL KGVLSLRDLIVADPRTRVAEIMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLV GIVTVDDVLDVLEAEATEDIHKLGAVDVPDLVYSEAGPVALWLARVRWLVILILTGMVTS SILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEM GVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPA LVSNPLVATLSDVTGLLIYLSVARLLLEAV
Uniprot No.

Target Background

Function
Serves as a highly selective magnesium channel.
Gene References Into Functions
  1. Data indicate that ATP regulates the Mg(+2)-dependent gating of MgtE. PMID: 28747715
  2. The cation selectivity mechanism involves the recognition of the hydrated Mg(2+) ion's geometry by the side-chain carboxylate groups within the selectivity filter. PMID: 25367295
Database Links
Protein Families
SLC41A transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Thermus thermophilus MgtE?

The MgtE magnesium transporter from Thermus thermophilus adopts a homodimeric architecture consisting of two major structural components: the carboxy-terminal five transmembrane domains and the amino-terminal cytosolic domains. The cytosolic domains are further subdivided into a superhelical N domain and tandemly repeated cystathionine-beta-synthase (CBS) domains. The transmembrane domains form a solvent-accessible pore that nearly traverses the membrane, with a potential Mg²⁺ binding site at the conserved Asp432 residue within this pore. The crystal structure has been determined at 3.5Å resolution for the full-length protein, while the cytosolic domain structures with and without bound Mg²⁺ have been resolved at 2.3Å and 3.9Å resolutions, respectively .

How does MgtE facilitate magnesium transport?

MgtE facilitates magnesium uptake across the cell membrane through an ion-dependent gating mechanism. The protein undergoes significant conformational changes upon Mg²⁺ binding at specific sites. In low magnesium conditions, the channel adopts an open conformation allowing Mg²⁺ to pass through the pore. When intracellular Mg²⁺ concentrations rise, Mg²⁺ ions bind to multiple sites in the cytosolic domains, triggering conformational changes that lead to channel closure. This regulatory mechanism is essential for maintaining proper magnesium homeostasis within the cell. The transmembrane (TM5) helices from both subunits close the pore through interactions with the 'connecting helices' that link the CBS and transmembrane domains .

What distinguishes MgtE from other magnesium transporters?

MgtE belongs to a distinct class of magnesium transporters that differs significantly from other known Mg²⁺ transport systems such as CorA. While both MgtE and CorA are constitutively active transporters, they exhibit different structural architectures and regulatory mechanisms. The MgtE family is ubiquitously distributed across all phylogenetic domains, with homologs found in bacteria, archaea, and eukaryotes, including humans. Unlike ATP-dependent transporters like MgtA and MgtB found in Salmonella typhimurium that require energy for transport, MgtE functions through Mg²⁺-dependent conformational changes. The SLC41 transporters in eukaryotes share the selectivity pore with MgtE but differ in other structural aspects .

What are the key Mg²⁺ binding sites in T. thermophilus MgtE and their functional roles?

T. thermophilus MgtE contains multiple Mg²⁺ binding sites with distinct functional roles in regulation and transport. Solution NMR spectroscopy studies have revealed that these sites have differential affinities for Mg²⁺ and contribute differently to the gating mechanism:

  • High-affinity sites (Mg1, Mg2, Mg3, and Mg6): These sites stabilize the structure of the transmembrane region upon Mg²⁺ binding.

  • Regulatory sites (Mg4, Mg5, and Mg7): These sites play critical roles in changing the conformation and dynamics of the cytoplasmic region, including the plug helices, leading to channel closure.

Four putative Mg²⁺ ions are bound at the interface between the connecting helices and other domains, which may lock the closed conformation of the pore. The following table summarizes the key Mg²⁺ binding sites in the cytosolic domain of MgtE from E. faecalis (which has high structural similarity to T. thermophilus MgtE) :

Binding site in E. faecalisCoordinating residuesAverage distance (Å)Equivalent site in T. thermophilusCoordinating residues in T. thermophilus
Mg1Glu71 (OE1)2.1NilNil
Mg2Asp230 (OD1), Arg227(O1)2.19, 2.11Mg5Asp226(OD1), Ala223(O1)
Mg3Asp102 (OD1), Ala140(O1)2.2, 2.1Mg6Asp95(OD1), Gly136(O1)
Mg4Asp98 (OD2), Asp251(OD2)2.11, 2.17Mg4Asp91 (OD2), Asp247(OD2)

How do structural changes correlate with the functional state of MgtE?

The functional state of MgtE is tightly regulated by Mg²⁺-induced structural changes. NMR spectroscopy experiments using wild-type and mutant forms of MgtE have revealed that Mg²⁺ binding induces significant conformational changes throughout the protein. When Mg²⁺ binds to the high-affinity sites (Mg1, Mg2, Mg3, and Mg6), it stabilizes the transmembrane region. Subsequently, Mg²⁺ binding to the regulatory sites (Mg4, Mg5, and Mg7) triggers changes in the conformation and dynamics of the cytoplasmic region, including the plug helices, leading to channel closure.

Mutational studies have shown that disruption of the Mg4 binding site (D91A/D247A mutations) prevents Mg²⁺-induced changes in specific residues of the CBS domain (e.g., I190), while mutations in other binding sites affect different parts of the protein. These structure-function correlations demonstrate how the protein uses Mg²⁺ sensing at multiple sites to regulate its transport activity in response to changing Mg²⁺ concentrations .

What insights have been gained from comparing MgtE structures across different species?

Comparative structural analyses of MgtE from different bacterial species have provided valuable insights into conserved features and species-specific adaptations:

These comparative analyses highlight both the evolutionary conservation of the core MgtE architecture and the species-specific adaptations that may reflect different physiological requirements for magnesium homeostasis .

What are the optimal conditions for expressing and purifying recombinant T. thermophilus MgtE?

Based on successful experimental protocols from published studies, the following approach is recommended for expressing and purifying recombinant T. thermophilus MgtE:

  • Expression system: Use Escherichia coli as the expression host, with a strong inducible promoter system (such as T7).

  • Construct design: Include an affinity tag (typically His-tag) for purification, with a protease cleavage site if tag removal is desired.

  • Culture conditions: Grow transformed E. coli cells at 37°C until reaching optimal density, then induce protein expression at a lower temperature (typically 18-20°C) to enhance proper folding.

  • Solubilization: Extract the membrane-bound MgtE using appropriate detergents; n-dodecyl-β-maltoside (DDM) has been successfully used in previous studies.

  • Purification: Use affinity chromatography followed by size exclusion chromatography to obtain homogeneous protein preparations. Size exclusion analysis typically indicates an apparent molecular weight of approximately 160 kDa, suggesting MgtE forms a dimer in detergent micelles.

  • Quality control: Assess protein purity by SDS-PAGE and functionality through activity assays or binding studies.

This protocol has been demonstrated to yield functionally active MgtE suitable for structural and biochemical analyses .

How can researchers effectively study Mg²⁺-dependent conformational changes in MgtE?

Several complementary techniques have proven effective for studying Mg²⁺-dependent conformational changes in MgtE:

  • Solution NMR spectroscopy: This technique has been particularly valuable for investigating Mg²⁺-induced structural changes in MgtE. Methyl-TROSY spectra of isotopically labeled MgtE (particularly at Ile δ1 methyl groups) provide high resolution and sensitivity for such a large membrane protein. This approach allows researchers to observe specific residues that undergo conformational changes upon Mg²⁺ binding.

  • X-ray crystallography: Determining crystal structures of MgtE in different states (with and without bound Mg²⁺) provides detailed structural information about conformational changes. Comparing structures of the cytosolic domain with and without Mg²⁺ has revealed significant conformational differences.

  • Site-directed mutagenesis: Creating mutations at specific Mg²⁺ binding sites allows researchers to dissect the functional roles of individual sites. For example, mutations like D91A/D247A (Mg4 site), D226N/D250A (Mg5 site), and E59A (Mg7 site) have been used to study how different binding sites contribute to conformational changes.

  • Functional assays: Combining structural studies with functional assays (such as ion transport measurements) helps correlate structural changes with functional outcomes.

These approaches, used in combination, provide comprehensive insights into how Mg²⁺ binding regulates MgtE structure and function .

What techniques can be used to assess the magnesium transport activity of recombinant MgtE?

Researchers can employ several complementary techniques to assess the magnesium transport activity of recombinant MgtE:

  • Electrophysiological measurements: Patch-clamp recordings of MgtE reconstituted in lipid bilayers or expressed in cell systems can directly measure ion conductance and selectivity. These measurements can determine transport rates, ion selectivity, and voltage dependence.

  • Radioactive isotope uptake assays: Using ²⁸Mg²⁺ or other radioactive magnesium isotopes to measure transport into proteoliposomes containing reconstituted MgtE or into cells expressing the transporter.

  • Fluorescent probes: Mag-fura-2 and similar fluorescent indicators can monitor intracellular free Mg²⁺ concentrations in real-time, allowing assessment of transport activity in cellular systems.

  • Growth complementation assays: Expressing MgtE in bacterial strains deficient in magnesium transport and assessing growth rescue under magnesium-limited conditions. This approach has been used with B. subtilis ΔmgtE strains, which exhibit Mg²⁺-dependent growth defects that can be complemented by functional MgtE expression .

  • Site-directed mutagenesis combined with functional assays: Creating mutations at key residues (particularly in Mg²⁺ binding sites or the pore region) and assessing their effects on transport activity can provide insights into structure-function relationships.

These methods, particularly when used in combination, provide robust assessment of MgtE transport activity and regulatory mechanisms .

How do MgtE mutations affect bacterial physiology beyond magnesium homeostasis?

Research on MgtE mutations has revealed impacts extending beyond simple magnesium homeostasis, affecting multiple aspects of bacterial physiology:

  • Virulence modulation: In Pseudomonas aeruginosa, MgtE functions as both a magnesium transporter and a virulence modulator. Studies have demonstrated that magnesium-binding sites in the connecting helix region of MgtE are vital in coupling these two functions. MgtE appears to play an important role in linking magnesium availability to P. aeruginosa pathogenesis, potentially through cytotoxicity-regulating functions .

  • Stress responses: In Bacillus subtilis, deletion of the mgtE gene not only causes magnesium-dependent growth defects but also increases sensitivity to hydrogen peroxide, suggesting a role in oxidative stress responses .

  • Manganese resistance: B. subtilis ΔmgtE mutants exhibit increased resistance to manganese compared to wild-type cells, indicating that MgtE may influence the homeostasis of other divalent cations beyond magnesium .

  • Sporulation: B. subtilis ΔmgtE strains show decreased sporulation efficiency, demonstrating that MgtE function impacts complex developmental processes .

  • Biofilm formation: While P. aeruginosa MgtE may not be directly involved in biofilm formation even under low-magnesium conditions, the interplay between magnesium homeostasis and bacterial adherence remains an area of ongoing investigation .

These findings highlight how MgtE functions extend beyond simple transport to influence multiple physiological processes, making it an important target for understanding bacterial adaptation and pathogenesis .

What is known about the evolutionary relationship between bacterial MgtE and eukaryotic SLC41 transporters?

The evolutionary relationship between bacterial MgtE and eukaryotic SLC41 transporters reveals both conserved features and significant divergences:

  • Structural conservation: The MgtE channel shares the selectivity pore structure with SLC41 Na⁺/Mg²⁺ transporters in eukaryotes, suggesting an evolutionary relationship focused on the core transport mechanism.

  • Functional divergence: While bacterial MgtE primarily functions as a Mg²⁺ channel, eukaryotic SLC41 proteins operate as Na⁺/Mg²⁺ transporters, indicating functional adaptation during evolution.

  • Domain architecture differences: Bacterial MgtE proteins contain distinctive N-terminal and CBS domains that regulate channel activity in response to Mg²⁺ concentration. These regulatory domains may have evolved differently in eukaryotic homologs to accommodate more complex cellular signaling networks.

  • Physiological roles: In bacteria, MgtE primarily functions in magnesium uptake, while eukaryotic SLC41 transporters may have more specialized roles in different tissues and cellular compartments.

  • Selective pressure: Conservation of the core transport mechanism across diverse species suggests strong evolutionary pressure to maintain magnesium transport capability, while regulatory mechanisms have diverged to meet the specific physiological requirements of different organisms.

This evolutionary relationship provides important context for understanding how magnesium transport systems have adapted across different domains of life while maintaining their core functionality .

How does the ion selectivity mechanism of MgtE compare with other ion channels and transporters?

The ion selectivity mechanism of MgtE presents several distinctive features when compared to other ion channels and transporters:

  • Hydration challenge: Mg²⁺ has the largest hydrated radius among all cations but the smallest ionic radius, creating a unique challenge for selective transport. MgtE must recognize and dehydrate the fully hydrated Mg²⁺ cation for transport, a process that distinguishes it from channels selective for other ions.

  • Selectivity filter structure: The MgtE pore contains a conserved aspartate residue (Asp432 in T. thermophilus) that is critical for Mg²⁺ coordination. This differs from potassium channels, which use a series of carbonyl oxygen atoms, or sodium channels, which use glutamate residues in different arrangements.

  • Gating mechanism: Unlike voltage-gated channels where membrane potential changes trigger conformational shifts, MgtE uses direct sensing of Mg²⁺ concentration through multiple binding sites to regulate channel opening and closing.

  • Coordination geometry: MgtE achieves selectivity for Mg²⁺ through specific coordination geometry at binding sites, typically involving aspartate and glutamate residues arranged to accommodate the precise ionic radius and charge density of Mg²⁺.

  • Regulatory domains: Unlike many other ion channels, MgtE contains extensive cytoplasmic domains (N and CBS domains) that serve as Mg²⁺ sensors, providing an intrinsic regulatory mechanism that couples transport activity directly to the concentration of the transported ion.

This unique combination of features allows MgtE to achieve high selectivity for Mg²⁺ while responding dynamically to changes in cellular magnesium levels .

How do the functional characteristics of T. thermophilus MgtE compare with MgtE proteins from other bacterial species?

Comparative analysis reveals both conserved and species-specific aspects of MgtE function across bacterial species:

SpeciesStructural FeaturesFunctional CharacteristicsPhysiological Roles
Thermus thermophilusHomodimeric with 5 TM domains; N and CBS cytosolic domains; Multiple Mg²⁺ binding sitesIon-dependent gating mechanism; Mg²⁺ binding sites with differential affinitiesPrimary Mg²⁺ transport system in thermophilic conditions
Pseudomonas aeruginosaStructural similarity to T. thermophilus MgtEDual function as Mg²⁺ transporter and virulence modulator; Not directly involved in biofilm formationLinks Mg²⁺ availability to pathogenesis; Regulates cytotoxicity
Bacillus subtilis34% identical to T. thermophilus MgtEMg²⁺-dependent growth; Manganese resistance; H₂O₂ sensitivityInfluences sporulation efficiency; Role in oxidative stress response
Enterococcus faecalisAdditional Mg²⁺ binding site compared to T. thermophilusSimilar Mg²⁺ binding coordination but with species-specific adaptationsNot fully characterized

These comparisons highlight how evolutionary adaptations have tailored MgtE function to the specific physiological requirements and ecological niches of different bacterial species while maintaining the core magnesium transport capability .

What are the current limitations in studying recombinant T. thermophilus MgtE and potential solutions?

Research on recombinant T. thermophilus MgtE faces several key limitations, each with potential solutions:

  • Limitation: Membrane protein expression and stability
    Solution: Optimize expression systems using specialized E. coli strains designed for membrane proteins; explore alternative expression hosts like yeast or insect cells; develop improved detergent and lipid nanodisc systems for stabilization.

  • Limitation: Difficulty in measuring direct Mg²⁺ transport in reconstituted systems
    Solution: Develop more sensitive fluorescent probes specific for Mg²⁺; implement advanced electrophysiological techniques; create novel assay systems combining structural and functional measurements.

  • Limitation: Resolving conformational dynamics during transport
    Solution: Apply advanced techniques like cryo-EM to capture multiple conformational states; use hydrogen-deuterium exchange mass spectrometry; implement single-molecule FRET to observe real-time conformational changes.

  • Limitation: Understanding the interplay between multiple Mg²⁺ binding sites
    Solution: Develop computational models integrating experimental data; apply systems biology approaches; create partially labeled proteins for site-specific analysis.

  • Limitation: Translating structural insights to physiological function
    Solution: Develop genetic systems in T. thermophilus for in vivo studies; create chimeric proteins to test domain functions across species; implement synthetic biology approaches to redesign MgtE with modified functions.

Addressing these limitations will require interdisciplinary approaches combining structural biology, biophysics, molecular biology, and computational methods .

What are the most promising future research directions for T. thermophilus MgtE studies?

Several promising research directions could significantly advance our understanding of T. thermophilus MgtE:

  • Structural dynamics during transport: Capturing the complete conformational cycle of MgtE during Mg²⁺ transport using techniques like time-resolved cryo-EM or advanced spectroscopic methods could reveal critical mechanistic details about how the protein alternates between different states.

  • Regulatory network integration: Investigating how MgtE functions within broader cellular regulatory networks, particularly in response to stress conditions or changes in metabolic state, would provide a systems-level understanding of magnesium homeostasis.

  • Synthetic biology applications: Engineering modified versions of MgtE with altered selectivity, regulation, or functionality could create valuable tools for biotechnology applications and provide insights into structure-function relationships.

  • Comparative biochemistry across extremophiles: Studying MgtE variants from different extremophilic bacteria could reveal adaptations that enable function under diverse environmental conditions and provide insights into evolutionary mechanisms.

  • Therapeutic targeting: Exploring the potential of MgtE as a target for antimicrobial development, particularly in pathogenic bacteria where MgtE plays roles in virulence, represents an important translational direction.

  • Integration with artificial intelligence: Applying machine learning approaches to predict functional consequences of MgtE mutations or to design improved experimental systems could accelerate research progress.

These directions represent opportunities to advance both fundamental understanding of magnesium transport mechanisms and potential applications in biotechnology and medicine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.