Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 10 (nqo10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqo10; TTHA0093; NADH-quinone oxidoreductase subunit 10; NADH dehydrogenase I chain 10; NDH-1 subunit 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Target Names
nqo10
Target Protein Sequence
MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYA GAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLK GGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPGKASRAKEAEKREEVAR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this organism, menaquinone serves as the enzyme's immediate electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving redox energy in a proton gradient crucial for ATP synthesis.
Database Links
Protein Families
Complex I subunit 6 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Thermus thermophilus NADH-quinone oxidoreductase?

NADH-quinone oxidoreductase (also called complex I) from Thermus thermophilus is a proton-translocating enzyme in the respiratory chain. While the mammalian mitochondrial version contains over 40 subunits, the bacterial counterpart in T. thermophilus consists of 14 subunits arranged in an L-shaped assembly with a hydrophilic peripheral arm and a hydrophobic membrane arm .

The enzyme couples electron transfer between NADH and quinone to proton translocation across the membrane. The electron transfer pathway is approximately 95 Å long, proceeding from the primary electron acceptor flavin mononucleotide through seven conserved iron–sulfur clusters to the quinone-binding site at the interface with the membrane domain .

Recent research has identified that contrary to previous assumptions, T. thermophilus complex I may contain proteins in addition to the "core" complement of 14 subunits, as evidenced by the discovery of a novel subunit named Nqo15 .

What are the optimal expression systems for recombinant T. thermophilus nqo10?

For expressing recombinant T. thermophilus nqo10, several expression systems have been successfully employed. The most commonly used is Escherichia coli with specific modifications for thermophilic protein expression:

  • E. coli BL21(DE3) with pET-based vectors containing T7 promoter systems

  • E. coli Rosetta or C43(DE3) strains for better handling of membrane proteins

  • Cold-shock expression systems with the cspA promoter

The optimal protocol involves:

  • Culturing at 37°C until OD600 reaches 0.6-0.8

  • Inducing with 0.5-1.0 mM IPTG

  • Shifting to 18-25°C for 16-20 hours to allow proper folding

  • Using defined media supplemented with trace elements, particularly iron and sulfur sources to support iron-sulfur cluster formation

For membrane proteins like nqo10, co-expression with chaperones (GroEL/GroES) can significantly improve the yield of correctly folded protein.

How can researchers optimize the solubility of recombinant nqo10 during expression?

As an advanced consideration, researchers should implement the following strategies to enhance nqo10 solubility:

  • Fusion tags optimization:

    • N-terminal His6 tag with a TEV protease cleavage site

    • MBP (maltose-binding protein) fusion for enhanced solubility

    • SUMO fusion systems for native N-terminus after cleavage

  • Expression conditions matrix:

    ParameterRange to testOptimal conditions
    Temperature15-30°C18°C
    IPTG concentration0.1-1.0 mM0.4 mM
    Expression time4-24 hours16 hours
    MediaLB, TB, M9TB supplemented with iron
  • Detergent screening for membrane domain solubilization:

    • Use mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG

    • Add lipids (0.01-0.05%) during purification to stabilize the protein

  • Co-expression strategies with other complex I subunits, particularly those that directly interact with nqo10, can improve folding and stability.

What is the standard purification protocol for recombinant nqo10?

The basic purification protocol for recombinant nqo10 involves:

  • Cell lysis in buffer containing:

    • 50 mM sodium phosphate, pH 7.5

    • 250 mM sucrose

    • Protease inhibitors

    • 1% detergent (typically DDM)

  • Affinity chromatography using the introduced tag (typically His6):

    • Ni-NTA resin equilibrated with lysis buffer containing 0.05% detergent

    • Wash with 20-50 mM imidazole

    • Elute with 250-300 mM imidazole

  • Size exclusion chromatography:

    • Superdex 200 column

    • Buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02% detergent

This protocol is adapted from methods used for membrane protein purification from thermophilic organisms, which typically show good stability during purification procedures .

How can researchers assess the integrity of iron-sulfur clusters during purification of nqo10-containing complexes?

For advanced purification considerations, researchers should monitor the integrity of the iron-sulfur clusters:

  • Spectroscopic analysis:

    • UV-visible spectroscopy (400-600 nm range) to monitor characteristic Fe-S absorption

    • EPR spectroscopy to identify the specific iron-sulfur cluster signals

    • Circular dichroism to assess protein folding and cofactor binding

  • Activity assays during purification:

    • NADH:ferricyanide oxidoreductase activity

    • NADH:quinone oxidoreductase activity with artificial quinones

  • Anaerobic techniques:

    • Purification under argon or nitrogen atmosphere

    • Addition of reducing agents (1-5 mM DTT or β-mercaptoethanol)

    • Use of oxygen-scavenging systems in buffers

  • Metal content analysis:

    • ICP-MS to quantify iron content

    • Iron to protein ratio determination

The temperature sensitivity should be carefully monitored, as iron-sulfur cluster integrity in thermophilic proteins often requires maintaining certain minimal temperatures (30-40°C) during purification to prevent structural changes that might occur at lower temperatures .

What techniques are suitable for structural characterization of purified nqo10?

For basic structural characterization of purified nqo10, researchers can employ:

  • Circular Dichroism (CD) spectroscopy:

    • Far-UV (190-250 nm) for secondary structure analysis

    • Near-UV (250-350 nm) for tertiary structure fingerprinting

  • Thermal stability analysis:

    • Differential Scanning Calorimetry (DSC)

    • Thermofluor assays to determine melting temperature

  • Limited proteolysis:

    • Identification of domain boundaries

    • Assessment of folding compactness

  • Homology modeling:

    • Based on available structures of homologous subunits

    • Validation through biochemical and biophysical data

How can researchers determine high-resolution structures of nqo10 within the complex I assembly?

Advanced structural characterization requires:

What are standard methods to assess the enzyme activity of preparations containing nqo10?

The basic functional characterization of nqo10-containing preparations includes:

  • NADH oxidation assays:

    • Spectrophotometric monitoring at 340 nm

    • Using various electron acceptors (ferricyanide, quinones)

    • Performed at elevated temperatures (42-65°C) to reflect thermophilic conditions

  • Proton pumping assays:

    • Reconstitution into proteoliposomes

    • pH electrode measurements

    • Fluorescent pH indicators

  • Inhibitor sensitivity:

    • Testing with known complex I inhibitors (rotenone, piericidin A)

    • Determining IC50 values

    • Competitive binding studies

These methods provide fundamental information about the catalytic properties and integrity of the complex containing nqo10.

How can researchers investigate the specific role of nqo10 in proton translocation?

Advanced functional studies to elucidate the role of nqo10 in proton translocation require:

  • Site-directed mutagenesis:

    • Mutation of conserved residues in transmembrane helices

    • Charge-inverting mutations in potential proton pathways

    • Creation of cysteine pairs for disulfide cross-linking studies

  • Reconstitution systems:

    • Development of a minimal subcomplex containing nqo10

    • Co-reconstitution with interacting subunits

    • Defined lipid composition to mimic native environment

  • Real-time proton translocation measurements:

    • Stopped-flow spectroscopy with pH-sensitive probes

    • Time-resolved FTIR spectroscopy for protonation state changes

    • Patch-clamp electrophysiology of reconstituted systems

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping conformational changes during catalysis

    • Identifying regions with altered solvent accessibility

    • Determining the dynamics of proton transfer pathways

These advanced techniques allow researchers to connect structural features of nqo10 with its functional role in the proton translocation mechanism of complex I.

How can recombinant T. thermophilus nqo10 be used as a model system for studying complex I-related diseases?

The basic applications of T. thermophilus nqo10 as a model system include:

  • Mutation modeling:

    • Creating equivalent disease-associated mutations found in human complex I

    • Biochemical characterization of mutant proteins

    • Structure-function correlation studies

  • Drug screening platforms:

    • Thermostable enzyme preparations for high-throughput screening

    • Identification of compounds that rescue mutant phenotypes

    • Validation of therapeutic targets

  • Understanding evolutionary conservation:

    • Comparative analysis of bacterial and human complex I

    • Identification of core functional elements conserved across species

    • Mapping of species-specific adaptations

These approaches leverage the relative simplicity and thermal stability of the T. thermophilus system to gain insights into the more complex human enzyme.

What advanced techniques can be applied to study the dynamics and conformational changes of nqo10 during the catalytic cycle?

For advanced research applications, investigators should consider:

  • Single-molecule techniques:

    • FRET studies with site-specific fluorophore labeling

    • Optical tweezers to measure force generation

    • High-speed AFM to visualize conformational states

  • Time-resolved spectroscopy:

    • Ultrafast transient absorption spectroscopy

    • Electron paramagnetic resonance (EPR) to track electron transfer

    • Resonance Raman spectroscopy for active site changes

  • Computational approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations

    • Molecular dynamics at different redox states

    • Markov state modeling of conformational transitions

  • Integrative structural biology during catalysis:

    StateTechniqueInformation obtained
    RestingCryo-EMBaseline conformation
    NADH-boundTime-resolved FRETInitial conformational change
    Electron transferEPR spectroscopyRedox state transitions
    Proton pumpingHDX-MSDynamic accessibility changes
    Inhibitor-boundX-ray crystallographyBlocked states

These approaches address the dynamic nature of complex I function, going beyond static structural information to understand the complete catalytic mechanism.

What factors contribute to the thermostability of T. thermophilus nqo10, and how can these be exploited in protein engineering?

The thermostability of T. thermophilus nqo10 results from:

  • Primary sequence adaptations:

    • Increased content of charged amino acids (Arg, Glu)

    • Higher proportion of hydrophobic core residues

    • Reduced number of thermolabile residues (Asn, Gln)

  • Structural features:

    • Enhanced electrostatic interactions

    • Increased number of ion pairs

    • More compact packing of hydrophobic cores

    • Enhanced secondary structure propensity

These features can be exploited for protein engineering through:

  • Rational design of thermostable variants of mesophilic proteins

  • Creation of chimeric proteins combining thermostable domains

  • Development of stabilizing fusion partners for difficult-to-express proteins

How can researchers engineer nqo10 to improve its suitability for biotechnological applications?

Advanced engineering of nqo10 for biotechnological applications involves:

  • Directed evolution strategies:

    • Error-prone PCR libraries

    • DNA shuffling with homologous proteins

    • Selection under conditions relevant to the application

  • Structure-guided engineering:

    • Introduction of disulfide bonds for stability

    • Surface modification for reduced aggregation

    • Active site redesign for altered substrate specificity

  • Specific modifications for biotechnological applications:

    ApplicationEngineering approachExpected outcome
    Biofuel cellsOptimize direct electron transfer to electrodesEnhanced current density
    BiosensorsCoupling electron transfer to signal generationImproved sensitivity and selectivity
    BiocatalysisActive site modifications for new substratesExpanded reaction scope
    NanomaterialsSurface functionalization for controlled assemblySelf-assembling protein structures
  • Experimental validation through:

    • Stability assays at varying temperatures and pH

    • Long-term storage testing

    • Activity measurements under application-specific conditions

    • Structural characterization of engineered variants

These engineering approaches can transform nqo10 from a model research protein into a valuable component for various biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.