Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 7 (nqo7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqo7; TTHA0084; NADH-quinone oxidoreductase subunit 7; NADH dehydrogenase I chain 7; NDH-1 subunit 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Target Names
nqo7
Target Protein Sequence
MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVH FYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, menaquinone serves as the immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred. This process generates the proton gradient essential for ATP synthesis.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Thermus thermophilus NADH-quinone oxidoreductase subunit 7 and why is it significant for research?

NADH-quinone oxidoreductase subunit 7 (nqo7) is a key component of the bacterial respiratory complex I (also called NDH-1) in Thermus thermophilus. This protein belongs to the proton-translocating NADH-quinone oxidoreductase complex (EC 1.6.99.3), which represents the largest and most complex enzyme of the respiratory chain .

The significance of nqo7 lies in its role within the electron transport chain where it participates in energy conservation processes. Compared to the mammalian mitochondrial complex I with over 40 subunits, the bacterial NDH-1 from Thermus thermophilus contains only 14 subunits, making it a structurally simpler yet functionally comparable model system for studying respiratory mechanisms . This comparative simplicity, combined with the thermostable properties of proteins from this thermophilic organism, makes nqo7 particularly valuable for structural and functional studies of respiratory complexes.

How does nqo7 differ functionally from its homologs in other species?

While nqo7 is specific to Thermus thermophilus, it has functional homologs in other organisms including the PSST subunit in mammalian complex I. Research has established that:

  • Both PSST in mammalian mitochondria and NQO6 in bacteria like Paracoccus denitrificans and Thermus thermophilus have conserved inhibitor-binding sites, suggesting evolutionary conservation of function

  • Despite functioning at different temperature optima, the core electron transfer mechanism appears preserved across species

  • Unlike mammalian systems which require numerous accessory subunits, Thermus thermophilus achieves similar functionality with fewer components, reflecting evolutionary adaptation to thermophilic environments

Research indicates that these subunits likely serve as key conduits in the transfer of electrons to quinone, functioning at a critical junction in the respiratory electron transport chain .

What are the optimal experimental conditions for studying nqo7 function?

When designing experiments to study nqo7 function, researchers should consider:

Buffer Composition:

  • HEPES-KOH buffer (pH 8.0) with 100 mM K-Glutamate and 10 mM Mg(OAc)₂

  • Addition of polyamines (particularly tetraamines like spermine at ~2 mM concentration)

  • Inclusion of reducing agents such as DTT (7.2 mM) to maintain protein stability

Temperature Considerations:

  • Standard assays can be performed at temperatures ranging from 37°C to 65°C

  • For thermostability studies, incremental temperature points between these ranges should be tested

  • Surprisingly, functional activity can be observed even at 37°C, despite this being below the minimum growth temperature for T. thermophilus

Experimental Design Principles:

  • Employ complete block designs when possible, with proper randomization of treatments

  • Consider factors such as temperature, pH, and inhibitor concentration as independent variables

  • Include appropriate controls and replicates to ensure statistical validity

How should researchers approach the reconstitution of systems containing nqo7?

Based on successful reconstitution experiments with Thermus thermophilus proteins, researchers should:

  • Component Preparation:

    • Purify ribosomes, total tRNAs, and recombinant proteins individually

    • Ensure high purity of each component to minimize experimental artifacts

    • For nqo7 specifically, maintain in Tris-based buffer with 50% glycerol

  • System Assembly:

    ComponentConcentrationFunction
    HEPES-KOH buffer50 mM, pH 8.0Maintains pH
    K-Glutamate100 mMProvides ionic strength
    Mg(OAc)₂10 mMStabilizes protein structure
    Spermine2 mMRequired for function at both high and low temperatures
    DTT7.2 mMMaintains reducing environment
    ATP/GTP2 mM eachProvides energy
  • Validation Steps:

    • Confirm functional integrity through activity assays

    • Verify protein-protein interactions through crosslinking or co-immunoprecipitation

    • Assess structural integrity through spectroscopic methods

What control experiments are essential when studying nqo7 interactions with inhibitors?

When investigating nqo7's interactions with inhibitors such as rotenone or piericidin A, essential controls include:

  • Dose-Response Relationships:

    • Test a range of inhibitor concentrations (typically nanomolar to micromolar)

    • Generate complete inhibition curves to determine IC₅₀ values

    • Compare potencies across different inhibitor classes

  • Specificity Controls:

    • Include structurally related but non-inhibitory compounds

    • Test inhibitors against purified nqo7 versus the intact complex

    • Perform competition assays between different inhibitors

  • Photoaffinity Labeling Controls:

    • Include excess unlabeled inhibitor to demonstrate specificity

    • Perform parallel labeling with related subunits to confirm target specificity

    • Use immunoprecipitation to verify labeling of the correct protein

Research has shown that photoaffinity labeling techniques have successfully identified the PSST subunit (homologous to bacterial NQO6) as a key binding site for multiple inhibitors, suggesting a similar approach could be productive for nqo7 studies .

What are the recommended methods for expression and purification of recombinant nqo7?

For optimal expression and purification of nqo7:

  • Expression System:

    • Use E. coli as a heterologous expression host

    • Employ a pET-based expression vector with a T7 promoter

    • Include an affinity tag (His-tag is commonly used) to facilitate purification

  • Culture Conditions:

    • Grow cultures at 37°C until reaching OD₆₀₀ of 0.6-0.8

    • Induce with IPTG (0.5-1 mM) for 4-6 hours

    • Consider lower induction temperatures (16-25°C) for improved solubility

  • Purification Protocol:

    Purification StepConditionsPurpose
    Cell lysisSonication or pressure-based methods in buffer containing detergentReleases membrane proteins
    Immobilized metal affinity chromatographyNi-NTA resin with imidazole gradient elutionCaptures His-tagged protein
    Size exclusion chromatographySuperdex 200 or similarRemoves aggregates and improves purity
    Buffer exchangeTo storage buffer with 50% glycerolStabilizes protein for storage
  • Storage Conditions:

    • Store in Tris-based buffer with 50% glycerol

    • Keep at -20°C for short-term or -80°C for long-term storage

    • Avoid repeated freeze-thaw cycles

How can researchers assess the structural integrity and functional activity of purified nqo7?

Several complementary approaches are recommended:

  • Structural Integrity Assessment:

    • SDS-PAGE for purity and molecular weight confirmation

    • Western blotting with specific antibodies

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Limited proteolysis to verify proper folding

  • Functional Activity Assays:

    • NADH oxidation assays (monitoring absorbance decrease at 340 nm)

    • Electron paramagnetic resonance (EPR) studies to assess iron-sulfur cluster integrity

    • Quinone reduction assays to measure terminal electron transfer

  • Interaction Studies:

    • Binding assays with known inhibitors

    • Co-purification with other complex subunits

    • Surface plasmon resonance to quantify binding kinetics

For thermostability assessment, researchers can employ thermal shift assays where protein samples are gradually heated while monitoring structural changes through fluorescence or spectroscopic methods .

How does nqo7 contribute to the coupling of electron transfer and proton translocation?

The mechanism of coupling electron transfer to proton translocation remains one of the fundamental questions in bioenergetics research. For nqo7:

  • Structural Position:

    • nqo7 is positioned at the critical interface between the hydrophilic (electron transfer) and hydrophobic (proton translocation) domains of the complex

    • This strategic location suggests it may participate in energy transduction between these domains

  • Functional Evidence:

    • Electron paramagnetic resonance studies establish that inhibitors like rotenone and piericidin A interrupt electron transfer between cluster N2 and quinone

    • The PSST subunit and its bacterial counterpart (functionally related to nqo7) are identified as target proteins for inhibitors that block this transfer

  • Proposed Mechanism:

    • nqo7 likely works in conjunction with iron-sulfur cluster N2 (the final cluster in the electron transfer path)

    • Conformational changes induced by electron transfer may be transmitted through nqo7 to trigger proton translocation events

    • The conserved cysteine motifs in nqo7's primary structure may be involved in coordination of redox-active centers

What approaches can resolve contradictions in nqo7 inhibitor binding studies?

Research has revealed apparent contradictions regarding inhibitor binding sites:

  • Conflicting Evidence:

    • Some studies suggest two inhibitor-binding sites with similar affinities but unequal contributions to inhibition

    • Other research indicates a single high-affinity binding region responsible for enzyme inhibition

  • Resolution Strategies:

    ApproachMethodologyExpected Outcome
    Direct binding studiesIsothermal titration calorimetry without albuminQuantitative binding parameters
    Site-directed mutagenesisSystematic mutation of putative binding residuesIdentification of critical binding determinants
    Structural studiesX-ray crystallography or cryo-EM with bound inhibitorsDirect visualization of binding sites
    Photoaffinity labelingUsing probes like (trifluoromethyl)diazirinyl[³H]pyridabenIdentification of specific binding proteins
  • Experimental Considerations:

    • Ensure protein is in native conformation during binding studies

    • Account for potential artifacts introduced by detergents or stabilizing agents

    • Consider cooperative effects between subunits in the intact complex

How might nqo7 research contribute to understanding mitochondrial diseases related to complex I dysfunction?

Despite being from a prokaryotic system, nqo7 research has implications for understanding human mitochondrial diseases:

  • Translational Relevance:

    • The bacterial NDH-1 complex serves as a simplified yet functionally homologous model for mammalian complex I

    • Insights into electron transfer mechanisms in bacterial systems can inform understanding of analogous processes in mitochondria

  • Research Applications:

    • Structure-function studies of nqo7 can reveal fundamental principles applicable to all complex I-type enzymes

    • Inhibitor binding studies may identify potential therapeutic targets or mechanisms

    • Understanding the precise electron transfer pathway can illuminate how mutations disrupt this process in disease

  • Methodological Transfer:

    • Techniques optimized for the thermostable bacterial protein can be adapted for studying less stable mammalian homologs

    • Reconstitution systems developed for bacterial complexes provide templates for mammalian studies

What are common challenges in nqo7 experimental work and how can they be addressed?

Researchers working with nqo7 frequently encounter several challenges:

  • Expression and Solubility Issues:

    • Problem: Poor expression or inclusion body formation

    • Solution: Optimize growth temperature, consider fusion partners, or test codon-optimized constructs

  • Maintaining Native Conformation:

    • Problem: Loss of structural integrity during purification

    • Solution: Include appropriate detergents, maintain reducing conditions, and purify in the presence of stabilizing agents

  • Assay Reproducibility:

    • Problem: Variable activity measurements between preparations

    • Solution: Implement stringent quality control measures, standardize assay conditions, and include internal controls

  • Temperature Sensitivity:

    • Problem: Protein instability during experimental manipulations

    • Solution: Maintain consistent temperature throughout purification and minimize exposure to denaturing conditions

How can experimental design principles improve nqo7 research outcomes?

Applying rigorous experimental design principles is crucial:

  • Replication Strategy:

    • Implement true biological replicates (independent protein preparations)

    • Include technical replicates to assess method precision

    • For complex experimental designs, consider incomplete block designs when full replications are impractical

  • Variable Control:

    • Identify and control experimental variables that affect nqo7 function

    • Randomize treatment assignment to experimental units

    • Consider blocking strategies to manage heterogeneity

  • Statistical Planning:

    • Determine appropriate sample sizes through power analysis

    • Plan appropriate statistical tests based on experimental design

    • Document all experimental conditions comprehensively to facilitate reproduction

What quality control metrics should be established for nqo7 preparations?

To ensure consistent, high-quality nqo7 preparations, researchers should establish:

  • Purity Standards:

    • ≥95% purity by SDS-PAGE

    • Single peak by size exclusion chromatography

    • Absence of degradation products by Western blot

  • Functional Criteria:

    • Reproducible activity measurements within ±10% of reference standard

    • Expected inhibitor sensitivity profile

    • Proper spectroscopic signatures for bound cofactors

  • Stability Metrics:

    • Consistent thermal denaturation profile

    • Minimal activity loss during storage (≤10% per month at recommended storage conditions)

    • Reproducible circular dichroism spectra between batches

By implementing these quality control measures, researchers can significantly improve experimental reproducibility and facilitate more meaningful comparisons between different studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.