Recombinant Thermus thermophilus Uncharacterized PIN and TRAM-domain containing protein TTHA0540 (TTHA0540)

Shipped with Ice Packs
In Stock

Description

General Information

TTHA0540 is a protein that contains both a PIN domain and a TRAM domain, which suggests it may be involved in RNA processing or transport, given the known functions of these domains in other proteins . The TTHA0540 protein is a full-length protein with a length of 24-336 amino acids .

Table 1: General Information of TTHA0540

CategoryInformation
Gene NameTTHA0540
SynonymsTTHA0540; Uncharacterized PIN and TRAM-domain containing protein TTHA0540; Putative RNase TTHA0540
UniProt IDQ5SKV3
SpeciesThermus thermophilus
SourceE. coli, Yeast, Baculovirus or Mammalian cell
Protein LengthFull Length of Mature Protein (24-336aa)
AA SequenceDWGLLPQSPSLLSLNRLYLALAGLLTGLLLGPRLEGALEARLKRLRSLPPEVVVATTLGSTIGLLLAVLLTTLLAQVPGFSPVHSLLLALGLVALFVYLALGYRAYFRLPEPKPAPRGGKVLDTSVLVDGRVAEVAAVGFLEGPLWVPHFVLKELQHFADSQDPLRRAKGRRGLETLERLREAAPLEVLETTPKGESVDEKLLFLARDLEAALVTNDHALLQMARIYGVKALSIQALAQALRPQLQVGDTLKLLILKEGKEPHQGVGYLEDGSMVVVDGGSRYRGQEIEVVVTQAIQTQVGRLFFARPAQGAQ
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended

Potential Functions

The presence of PIN and TRAM domains suggests several potential functions for TTHA0540:

  1. RNA Processing: PIN domains are often found in proteins involved in RNA processing, such as ribonucleases . TTHA0540 might be involved in RNA degradation or modification.

  2. Membrane Association: The TRAM domain suggests an association with the cell membrane, potentially playing a role in protein translocation or membrane organization .

  3. Thermostability: As a protein from a thermophilic organism, TTHA0540 likely possesses structural adaptations that contribute to its stability at high temperatures . These adaptations may involve an increased number of hydrogen bonds, ion pairs, or other stabilizing interactions.

Research and Applications

As an uncharacterized protein, TTHA0540 is a target for structural and functional studies to elucidate its specific role in Thermus thermophilus . Potential research directions include:

  • Structural Determination: Determining the crystal structure of TTHA0540 could provide insights into its function and stability .

  • Biochemical Assays: Performing in vitro assays to test its activity on RNA substrates or its interaction with other proteins .

  • Genetic Studies: Mutating the TTHA0540 gene in T. thermophilus to observe the resulting phenotype and infer its function.

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TTHA0540; Uncharacterized PIN and TRAM-domain containing protein TTHA0540; Putative RNase TTHA0540
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-336
Protein Length
Full Length of Mature Protein
Species
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Target Names
TTHA0540
Target Protein Sequence
DWGLLPQSPSLLSLNRLYLALAGLLTGLLLGPRLEGALEARLKRLRSLPPEVVVATTLGS TIGLLLAVLLTTLLAQVPGFSPVHSLLLALGLVALFVYLALGYRAYFRLPEPKPAPRGGK VLDTSVLVDGRVAEVAAVGFLEGPLWVPHFVLKELQHFADSQDPLRRAKGRRGLETLERL REAAPLEVLETTPKGESVDEKLLFLARDLEAALVTNDHALLQMARIYGVKALSIQALAQA LRPQLQVGDTLKLLILKEGKEPHQGVGYLEDGSMVVVDGGSRYRGQEIEVVVTQAIQTQV GRLFFARPAQGAQ
Uniprot No.

Target Background

Function

Part of a toxin-antitoxin (TA) system. It functions as an RNase.

Database Links
Protein Families
PINc/VapC protein family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TTHA0540 and what are its structural characteristics?

TTHA0540 is an uncharacterized protein from the thermophilic bacterium Thermus thermophilus HB8. Structurally, it contains both PIN (PilT N-terminus) and TRAM (tRNA methyltransferase) domains, suggesting potential nucleic acid-related functions. The full-length mature protein spans amino acids 24-336, with a total of 312 amino acid residues . The protein's thermostability, characteristic of proteins from T. thermophilus, makes it potentially valuable for applications requiring high-temperature stability.

The PIN domain is typically associated with nuclease activity, particularly in prokaryotic toxin-antitoxin systems, while TRAM domains are often involved in RNA binding. The co-occurrence of these domains in TTHA0540 suggests a potential role in RNA metabolism, possibly in RNA quality control, degradation, or processing pathways.

What is the gene expression profile of TTHA0540 in Thermus thermophilus?

Research involving gene disruptant strains of Thermus thermophilus HB8 has been conducted to investigate the expression profile of TTHA0540 . Specifically, RNA samples from TTHA0540 gene disruptant strains during logarithmic growth phase have been analyzed, suggesting that researchers have investigated the effects of TTHA0540 deletion on gene expression patterns in T. thermophilus .

Expression studies indicate that TTHA0540 may be differentially regulated in response to environmental conditions. The gene appears to be expressed during normal growth conditions, but detailed expression profiles across different growth phases and stress conditions would require further investigation through methods such as RNA-seq, qRT-PCR, or microarray analysis.

What is the predicted biological function of TTHA0540 based on domain analysis?

The presence of both PIN and TRAM domains in TTHA0540 suggests a potential role in RNA metabolism. The PIN domain is typically associated with ribonuclease activity and is found in proteins involved in mRNA degradation, RNA processing, and quality control pathways. The TRAM domain, originally identified in tRNA methyltransferases, is involved in RNA binding.

The combination of these domains suggests that TTHA0540 might function in:

  • RNA surveillance mechanisms

  • Processing of structured RNAs

  • Degradation of specific RNA species

  • Quality control of RNA molecules during stress conditions

Given T. thermophilus' thermophilic nature, TTHA0540 likely performs these functions at elevated temperatures, potentially contributing to RNA stability or turnover in thermophilic environments.

How does gene disruption of TTHA0540 affect the transcriptome of T. thermophilus HB8?

Gene disruption studies have been conducted for TTHA0540 in T. thermophilus HB8, with researchers specifically examining the logarithmic growth phase of the disruptant strain . The experimental design involved adding an equal volume of hot medium to the TTHA0540 disruptant culture, suggesting an investigation of heat shock or stress response mechanisms .

A comprehensive transcriptome analysis would likely reveal downstream effects of TTHA0540 deletion. Given the protein's predicted involvement in RNA metabolism, disruption could lead to:

  • Accumulation of specific RNA species that would normally be processed or degraded

  • Altered expression of genes involved in stress response pathways

  • Changes in growth characteristics or viability under specific conditions

  • Compensatory upregulation of functionally related genes

Researchers should employ RNA-seq or microarray analysis to compare wild-type and TTHA0540 knockout strains under various conditions, including different growth phases and stress conditions relevant to thermophilic environments.

What are the biochemical properties of the PIN domain in TTHA0540 and how do they compare to canonical PIN domains?

  • Site-directed mutagenesis of conserved catalytic residues

  • In vitro nuclease assays with various substrates (ssRNA, dsRNA, DNA)

  • Metal ion dependency studies (typically Mg²⁺ or Mn²⁺)

  • Structural analysis through X-ray crystallography or cryo-EM

Researchers investigating TTHA0540's PIN domain should consider how its thermostable nature might affect catalytic properties compared to mesophilic PIN domains. Thermal stability assays and activity measurements across a temperature range would provide valuable insights into potential adaptations for function at elevated temperatures.

What is the potential interplay between the PIN and TRAM domains in TTHA0540?

The co-occurrence of PIN and TRAM domains in TTHA0540 presents an intriguing research question regarding their functional interplay. Researchers should consider:

  • Whether the TRAM domain provides substrate specificity for the nuclease activity of the PIN domain

  • If the domains function independently or cooperatively

  • How thermostability affects the domain interaction compared to mesophilic proteins with similar domain architecture

To investigate this interplay, researchers could:

  • Generate constructs with individual domains and compare their activities to the full-length protein

  • Perform RNA binding assays to identify specific targets of the TRAM domain

  • Use structural biology approaches to determine the relative orientation of domains

  • Conduct in vivo studies with domain-specific mutations to assess phenotypic effects

What are the optimal conditions for expressing and purifying recombinant TTHA0540?

Recombinant TTHA0540 can be expressed in E. coli as a His-tagged protein encompassing the full-length mature protein (amino acids 24-336) . Based on general approaches for thermostable proteins, researchers should consider:

Expression System Optimization:

  • E. coli BL21(DE3) or Rosetta strains are typically suitable

  • Consider low-temperature induction (16-20°C) despite the thermostable nature of the protein

  • IPTG concentration: 0.1-0.5 mM

  • Induction time: 4-16 hours

Purification Protocol:

  • Harvest cells and resuspend in lysis buffer (typically 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole)

  • Lyse cells via sonication or French press

  • Centrifuge at high speed (20,000 × g, 30 min) to remove cell debris

  • Apply supernatant to Ni-NTA column

  • Wash with increasing imidazole concentrations

  • Elute with 250-300 mM imidazole

  • Consider heat treatment (70-80°C for 10-15 minutes) to remove E. coli proteins

  • Further purify via size exclusion chromatography if needed

For functional studies, researchers should test whether the His-tag affects activity and consider TEV protease cleavage if necessary.

What assays can be used to investigate the potential nuclease activity of TTHA0540?

To characterize the potential nuclease activity of TTHA0540, researchers should consider the following methodological approaches:

Substrate Preparation:

  • Synthetic RNA oligonucleotides with different structures (5'-end labeled)

  • In vitro transcribed RNAs of varying lengths and structures

  • Total RNA extracted from T. thermophilus or heterologous systems

Nuclease Activity Assays:

  • Gel-based assays: Incubate purified TTHA0540 with labeled RNA substrates, separate on denaturing polyacrylamide gels, and visualize cleavage products

  • FRET-based assays: Use dual-labeled RNA substrates to monitor cleavage in real-time

  • High-throughput sequencing: Identify cleavage sites at the transcriptome-wide level

Reaction Conditions to Test:

  • Temperature range (30-80°C)

  • pH range (5.0-9.0)

  • Metal ion dependencies (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)

  • Salt concentrations (50-500 mM)

Control Experiments:

  • Heat-inactivated TTHA0540

  • Catalytic site mutants

  • Domain deletion variants

How can researchers design experiments to identify potential interaction partners of TTHA0540?

Understanding the protein interaction network of TTHA0540 is crucial for elucidating its biological function. Researchers should employ multiple complementary approaches:

In Vitro Methods:

  • Pull-down assays: Use purified His-tagged TTHA0540 as bait to capture interacting proteins from T. thermophilus lysates

  • Surface Plasmon Resonance (SPR): Evaluate direct binding to candidate partners

  • Isothermal Titration Calorimetry (ITC): Determine binding affinities and thermodynamic parameters

In Vivo Methods:

  • Co-immunoprecipitation: Express tagged TTHA0540 in T. thermophilus and identify co-precipitating proteins

  • Bacterial two-hybrid systems: Screen for protein-protein interactions

  • Proximity-dependent biotin labeling: Identify proteins in close proximity to TTHA0540 in vivo

Bioinformatic Approaches:

  • Co-expression analysis: Identify genes with similar expression patterns

  • Genome context analysis: Examine neighboring genes and operonic structure

  • Phylogenetic profiling: Identify proteins with similar evolutionary distribution

Research indicates that co-immunoprecipitation techniques can successfully identify protein-protein interactions in thermophilic bacteria . When analyzing potential interaction partners, researchers should consider proteins involved in RNA metabolism pathways as high-priority candidates.

How should researchers interpret growth phenotypes of TTHA0540 gene disruptant strains?

When analyzing growth phenotypes of TTHA0540 gene disruptant strains, researchers should:

  • Compare growth curves of wild-type and disruptant strains under standard conditions

  • Evaluate growth under stress conditions relevant to thermophiles (heat shock, nutrient limitation)

  • Assess biofilm formation and cellular morphology

  • Quantify survival rates under various stress conditions

Interpretation should consider:

  • The potential redundancy in RNA processing pathways

  • Growth phase-dependent effects (as suggested by the focus on log phase samples in previous studies)

  • Stress-specific phenotypes that may only manifest under certain conditions

  • Comparisons with phenotypes of other RNA metabolism mutants

Statistical analysis should include:

  • Biological replicates (minimum n=3)

  • Appropriate controls (wild-type, complemented strains)

  • Time-series analysis rather than endpoint measurements

  • Correlation with transcriptomic or proteomic changes

What approaches should be used to analyze the substrate specificity of TTHA0540?

Determining the substrate specificity of TTHA0540 requires a systematic approach combining in vitro and in vivo methods:

In Vitro Substrate Screening:

  • Test activity against various RNA types:

    • Ribosomal RNA

    • Transfer RNA

    • Messenger RNA

    • Small non-coding RNAs

  • Evaluate sequence preferences using RNA libraries

  • Assess structure preferences (single-stranded vs. structured regions)

In Vivo Approaches:

  • RNA-seq analysis comparing wild-type and TTHA0540 disruptant strains

  • CLIP-seq (Cross-linking immunoprecipitation followed by sequencing) to identify direct RNA targets

  • Ribosome profiling to assess effects on translation

Data Analysis Pipeline:

  • Identify enriched sequence or structural motifs in preferred substrates

  • Compare with known targets of other PIN domain proteins

  • Correlate in vitro preferences with in vivo accumulation in disruptant strains

  • Develop predictive models of substrate recognition

This comprehensive approach will provide insights into both the biochemical activity and biological function of TTHA0540.

What are the potential applications of TTHA0540 in biotechnology and molecular biology?

The thermostable nature of TTHA0540, combined with its potential nuclease activity, suggests several applications:

  • Development of thermostable molecular biology tools:

    • RNA processing enzymes for high-temperature reactions

    • Components for isothermal amplification methods

    • Heat-resistant ribonucleases for specific RNA targeting

  • Structural biology applications:

    • Model system for studying PIN-TRAM domain interactions

    • Understanding protein adaptations to extreme temperatures

  • Synthetic biology applications:

    • Engineered RNA regulatory systems using thermostable components

    • Development of orthogonal RNA processing systems

  • Therapeutic applications:

    • Template for designing thermostable RNA-targeting enzymes

    • Potential antimicrobial targets against thermophilic pathogens

Future research should focus on fully characterizing the biochemical properties and substrate specificity of TTHA0540 before developing these applications.

How can researchers formulate effective research questions to advance understanding of TTHA0540 function?

Formulating effective research questions for TTHA0540 should follow systematic approaches as outlined in scientific literature on research methodology . Researchers should:

  • Identify knowledge gaps: Begin by recognizing what is currently unknown about TTHA0540

  • Ensure relevance: Questions should connect to broader understanding of RNA metabolism or thermophile biology

  • Ensure manageability: Questions should be answerable with available methodologies

  • Ensure complexity: Questions should require analysis beyond simple description

  • Ensure measurability: Questions should lead to quantifiable outcomes

Following the FINER criteria (Feasible, Interesting, Novel, Ethical, Relevant), researchers might consider these template questions:

  • "How does TTHA0540 contribute to RNA quality control during heat shock in T. thermophilus?"

  • "What is the mechanistic basis for substrate recognition by the TTHA0540 PIN-TRAM domain combination?"

  • "How has the function of TTHA0540 evolved compared to homologous proteins in mesophilic bacteria?"

These questions should be refined based on preliminary data and literature reviews . The research design should be guided by the specific question being addressed, with appropriate controls and methodologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.