Recombinant Thermus thermophilus UPF0365 protein TT_C0686 (TT_C0686)

Shipped with Ice Packs
In Stock

Description

Functional and Biochemical Properties

While no direct functional data exist for TT_C0686, its classification as a UPF0365 family member suggests roles in:

  • Membrane Organization: Analogous to flotillin proteins in eukaryotes, which cluster membrane proteins and lipids.

  • Signaling Pathways: Putative involvement in stress response or metabolic regulation, inferred from homologs in extremophiles.

Biochemical assays (e.g., enzyme activity, binding studies) have not been reported, likely due to the protein’s uncharacterized nature. Researchers typically use this recombinant form as a tool for:

  • Immunoassays (e.g., ELISA validation) .

  • Structural Studies (e.g., X-ray crystallography or cryo-EM).

Applications and Research Findings

TT_C0686 serves primarily as a reference material in molecular biology and biotechnology:

ApplicationDetails
ELISA DevelopmentUsed as a coating antigen in sandwich ELISA kits for antibody validation .
Protein Interaction StudiesPotential use in pulldown assays to identify binding partners, though no published data exist.
Thermal StabilityNot explicitly tested, but T. thermophilus proteins typically retain activity at high temperatures .

Research Gaps and Future Directions

  • Functional Characterization: No studies have explored TT_C0686’s role in T. thermophilus physiology.

  • Comparative Analysis: Homologs in other thermophiles (e.g., Thermococcus kodakarensis) may provide insights into conserved functions.

  • Industrial Applications: Potential utility in biocatalysis or biofuel production, given T. thermophilus’s thermoresistance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; TT_C0686; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
Target Names
TT_C0686
Target Protein Sequence
MEGLGIVFLAAVVLLFVFLFFSFIPVGLWISAWAAGVRVPLLTLVAMRLRRVPPAKIIYP LIKATKAGLDVRLDRLEAHYLAGGNVDRVVDALIAADKAGIKLTFDRAAAIDLAGRDVLE AVRVSVNPKVIQTPMVAAVAKDGIQLLATARVTVRANIDRLVGGAGEETIIARVGEGIVT TIGSANSHKEVLENPDRISKTVLEKGLDAGTAFEILSVDIADVDVGKNIGAQLQIDQAEA DKKIAQAKAEERRAMAVAAEQENRALVEAMRAKLVEAQAQVPLALAEALRKGHLGVMDYY RLKNIEADTDMRESISRAAKPEGEE
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is Recombinant Thermus thermophilus UPF0365 protein TT_C0686?

Recombinant Thermus thermophilus UPF0365 protein TT_C0686 (also known as FloA or Flotillin-like protein FloA) is a full-length protein (amino acids 1-325) derived from the thermophilic bacterium Thermus thermophilus. This protein has the UniProt ID Q72JT2 and is typically expressed in E. coli with an N-terminal His tag for purification purposes . The protein is obtained from Thermus thermophilus strain HB27 / ATCC BAA-163 / DSM 7039, a thermophilic bacterium that thrives at temperatures between 65-75°C . As a protein from a thermophilic organism, TT_C0686 exhibits exceptional thermal stability, making it valuable for various high-temperature biochemical applications and structural biology studies .

For research applications, this recombinant protein is typically provided as a lyophilized powder that requires proper reconstitution before use. While the exact function of this UPF0365 family protein is not fully characterized, its relationship to flotillin suggests potential involvement in membrane organization and microdomains formation in thermophilic environments.

What are the optimal storage conditions for TT_C0686 protein?

Based on the product information available, the optimal storage conditions for Recombinant Thermus thermophilus UPF0365 protein TT_C0686 follow specific parameters to maintain stability and activity:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, pH 8.0, with 6% Trehalose or Tris-based buffer with 50% glycerol
FormLyophilized powder (before reconstitution)
Important considerationsAvoid repeated freeze-thaw cycles

The methodological approach for optimal storage includes several critical steps :

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom before opening

  • After reconstitution, divide the protein into smaller working aliquots to minimize freeze-thaw cycles

  • For daily experimental use, maintain working aliquots at 4°C for no longer than one week

  • For extended storage periods, maintain aliquots at -20°C or preferably -80°C in appropriate storage buffer

  • When thawing, allow the protein to thaw gradually at 4°C rather than at room temperature

This careful storage protocol helps maintain the structural integrity and activity of the protein, particularly important for experiments requiring consistent protein performance across multiple assays.

How should I reconstitute TT_C0686 protein for experimental use?

Proper reconstitution of lyophilized TT_C0686 protein is critical for maintaining its structural integrity and activity. The following methodological approach is recommended based on the product information:

  • Centrifugation: Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitution solution: Use deionized sterile water to reconstitute the protein

  • Concentration: Achieve a final concentration of 0.1-1.0 mg/mL

  • Glycerol addition: Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Aliquoting: Divide the reconstituted protein into smaller volumes to avoid repeated freeze-thaw cycles

  • Storage: Store aliquots according to the storage guidelines outlined previously

The reconstitution buffer (Tris/PBS-based, pH 8.0, with 6% Trehalose) is specifically designed to maintain protein stability . The addition of glycerol serves as a cryoprotectant to prevent damage during freeze-thaw cycles and helps maintain the protein in solution at low temperatures.

For experimental design considerations, it's important to verify that the reconstitution buffer components will not interfere with your specific assay conditions. If necessary, buffer exchange using dialysis or desalting columns may be performed after reconstitution, particularly for experiments sensitive to buffer composition or requiring specific ionic conditions.

What are the expression systems used for producing TT_C0686 protein?

Based on the available product information, the primary expression system used for producing recombinant TT_C0686 protein is Escherichia coli . The methodological approach typically involves:

Expression ParameterDetails
Expression hostE. coli
Expression regionFull length (amino acids 1-325)
TagN-terminal His-tag for purification
Purification methodAffinity chromatography using His-tag
Purity>90% as determined by SDS-PAGE
Product formLyophilized powder

For researchers looking to produce this protein in-house, the following methodology is recommended:

  • Clone the TT_C0686 gene into an appropriate expression vector with an N-terminal His-tag

  • Transform the construct into an E. coli expression strain (BL21(DE3) or similar)

  • Optimize expression conditions, considering that proteins from thermophilic organisms often require higher induction temperatures

  • Perform protein extraction and affinity purification using Ni-NTA or similar matrices

  • Conduct quality control by SDS-PAGE to verify purity (target >90% purity)

  • Consider additional purification steps like size exclusion chromatography if higher purity is required

E. coli is preferred as an expression host due to its simplicity, rapid growth, and high protein yields. This approach has been successfully used for other thermostable proteins from Thermus thermophilus, as demonstrated in research on the TthCsm complex, which was reconstituted by co-overexpression in E. coli .

How can thermostable experimental systems be designed using TT_C0686 protein?

Designing thermostable experimental systems using TT_C0686 requires careful consideration of temperature effects on all components. Based on studies with other Thermus thermophilus proteins, the following methodological approach is recommended:

  • Temperature Optimization:

    • Research with other T. thermophilus proteins shows that "RNA cleavage was minimal at 37°C, but robust at 65°C," indicating that experiments should be conducted at elevated temperatures

    • Experimental evidence demonstrates that "binding of an RNA molecule complementary to the crRNA guide sequence within TthCsm is required for sequence-independent DNA cleavage," suggesting that molecular interactions are temperature-dependent

    • Design temperature gradients (37°C, 50°C, 65°C, 75°C) to determine optimal conditions for your specific experimental system

  • Buffer System Design:

    • Use temperature-stable buffers with minimal pH shifts at high temperatures

    • Include appropriate stabilizing agents (glycerol, trehalose) in reaction buffers

    • Pre-warm all reaction components to target temperature before initiating reactions

  • Control Design:

    • Include parallel experiments at both standard (37°C) and thermophilic (65-75°C) temperatures

    • Use well-characterized thermostable proteins as positive controls

    • Design temperature-matched controls for all experimental conditions

  • Experimental Strategy Based on Thermus thermophilus Research:

    • "Target RNA pre-incubation with TthCsm at 65°C in the absence of metal ions, followed by cooling to 37°C" resulted in higher activity than reactions performed entirely at 37°C, suggesting a similar approach might be valuable for TT_C0686 experiments

    • Consider both binding and catalytic activities may have different temperature optima

    • Apply experimental design principles including "defining variables, writing specific testable hypotheses, and controlling extraneous variables"

The thermostability of TT_C0686 makes it an excellent candidate for structural biology studies and biotechnological applications requiring heat-resistant proteins. When designing such systems, it's crucial to account for the temperature effects on all experimental components to ensure consistent and reliable results.

What are the structural characteristics of TT_C0686 protein and how do they relate to its function?

While detailed structural information specifically for TT_C0686 is limited in the available literature, we can make informed analyses based on sequence characteristics and known properties of the UPF0365 protein family and flotillin-like proteins:

Predicted Structural Features:

  • Membrane Association:

    • The N-terminal sequence (MEGLGIVFLAAVVLLFVFLFF) contains a stretch of hydrophobic amino acids characteristic of membrane-associated proteins

    • As a flotillin-like protein (FloA), TT_C0686 likely associates with the bacterial cell membrane, potentially involved in organizing membrane microdomains

  • Domain Organization:

    • Flotillins typically contain a SPFH (Stomatin/Prohibitin/Flotillin/HflK/C) domain

    • The C-terminal region often contains flotillin-specific repeats that may form coiled-coil structures important for protein-protein interactions

    • The thermostability of the protein suggests structural features that confer resistance to heat denaturation, such as increased hydrophobic interactions, ionic bonds, and compact folding

  • Thermostability Determinants:

    • Proteins from Thermus thermophilus typically display higher content of charged amino acids forming salt bridges

    • Increased proline residues in loop regions

    • More extensive hydrophobic cores that remain stable at elevated temperatures

Structure-Function Relationship:

Structural FeaturePotential Functional Implication
Membrane associationMicrodomains formation and membrane organization at high temperatures
SPFH domainProtein-protein interactions and scaffold function
Thermostable foldMaintenance of structure and function at 65-75°C
Potential oligomerization interfacesFormation of higher-order complexes important for function

The thermostability of TT_C0686, being from Thermus thermophilus which "grows optimally at temperatures of ~65–75°C" , is particularly interesting as it suggests adaptation of membrane organization mechanisms to high-temperature environments. This characteristic could be valuable for developing thermostable experimental systems or understanding membrane biology in extremophiles.

For definitive structural characterization, experimental approaches like X-ray crystallography, cryo-EM, or NMR spectroscopy would be necessary. Evidence from studies with other Thermus thermophilus proteins suggests that "TthCsm complex is amenable to negative stain EM analysis, making it an attractive candidate for structural studies using cryo-EM" , indicating similar approaches might be successful for TT_C0686.

How can experimental design be optimized when working with thermophilic proteins like TT_C0686?

Working with thermophilic proteins like TT_C0686 requires specialized experimental design considerations. Based on established principles and research with other Thermus thermophilus proteins, the following methodological framework is recommended:

Define Variables and Controls:

Following experimental design principles, clearly identify variables in your system :

  • Independent variables: Temperature, buffer composition, protein concentration

  • Dependent variables: Protein activity, stability, binding affinity

  • Controlled variables: pH, ionic strength, incubation time

Research with Thermus thermophilus proteins demonstrates that "both RNA binding and cleavage by TthCsm are more efficient at high temperatures" , suggesting temperature is a critical variable to control and optimize.

Temperature Optimization Protocol:

  • Gradient Analysis:

    • Design experiments with temperature points from 37°C to 75°C

    • Evidence from TthCsm research showed "RNA cleavage was minimal at 37°C, but robust at 65°C"

  • Pre-incubation Strategy:

    • Test the effect of pre-incubation at high temperature followed by reaction at lower temperature

    • Data from TthCsm showed "target RNA pre-incubation with TthCsm at 65°C in the absence of metal ions, followed by cooling to 37°C, resulted in a somewhat higher level of RNA cleavage than the reaction performed entirely at 37°C"

Buffer Optimization:

Buffer ComponentOptimization Strategy
pHTest range from 6.5-8.5; use buffers with minimal temperature-dependent pH shifts
Salt concentrationEvaluate 50-500 mM NaCl range; higher ionic strength may stabilize thermophilic proteins
Stabilizing agentsTest effects of glycerol (5-50%), trehalose (1-10%)
Divalent cationsAssess Mg²⁺, Ca²⁺, Mn²⁺ requirements (1-10 mM)

Advanced Optimization Strategies:

  • Consider Bayesian experimental design approaches:

    • Especially valuable for optimizing multiple parameters simultaneously

    • Provides a mathematical definition of the expected information gain (EIG) of each experimental condition

    • Helps identify the most informative experiments to run next, reducing the total number of experiments needed

By systematically applying these experimental design principles and learning from previous work with Thermus thermophilus proteins, researchers can develop robust protocols for working with TT_C0686 that account for its unique thermophilic properties.

What technical considerations are important for high-temperature biochemical assays with TT_C0686?

When conducting high-temperature biochemical assays with TT_C0686, several technical considerations must be addressed to ensure experimental success and reliable results:

Equipment and Materials:

  • Temperature-stable labware:

    • Use polypropylene or metal tubes instead of standard plastics that may deform

    • Ensure caps and seals can withstand high temperatures without leaking

    • Consider screw-cap tubes or oil overlays to prevent evaporation during extended incubations

  • Instrumentation:

    • Calibrate thermocyclers and heat blocks to ensure accurate temperature delivery

    • Account for temperature gradients within heating blocks (edge effects)

    • Use instruments with good temperature uniformity across all sample positions

    • Allow sufficient equilibration time when changing temperatures

Buffer and Reagent Considerations:

ComponentHigh-Temperature Consideration
BuffersUse HEPES or phosphate buffers that maintain pH at high temperatures
EnzymesPair with thermostable enzymes (e.g., those from Thermus thermophilus)
SubstratesMay require higher concentrations due to increased degradation rates
Reducing agentsReplace DTT with more thermostable alternatives like TCEP
GlycerolCan help stabilize proteins but may affect viscosity at high concentrations

Reaction Kinetics Adjustment:

  • Time course optimization:

    • Reaction rates generally increase with temperature (Arrhenius equation)

    • What takes hours at 37°C may occur in minutes at 65°C

    • Design time-course experiments with more frequent early sampling

  • Enzyme concentration adjustment:

    • May need to reduce enzyme concentrations at higher temperatures to avoid rapid substrate depletion

    • Titrate protein concentration across a broader range than would be used at standard temperatures

Temperature-Specific Controls:

Evidence from studies with TthCsm complex demonstrates the importance of temperature controls:

  • "RNA cleavage was minimal at 37°C, but robust at 65°C"

  • "The amount of RNA that was gel-shifted at 37°C was significantly less than at 65°C"

Therefore, include:

  • Parallel reactions at 37°C and 65-75°C

  • Step-wise temperature profiles to identify optimal conditions

  • Pre-incubation experiments to separate temperature effects on binding versus catalytic activity

Data Analysis Considerations:

  • Apply appropriate statistical methods for experimental data as outlined in tableone package documentation :

    • For continuous variables: report mean, SD, median, IQR as appropriate

    • Generate warning flags for inappropriate data summaries

    • Identify outliers using established statistical methods like Tukey's test

  • Temperature normalization:

    • Express activity relative to optimal temperature

    • Account for non-specific temperature effects on assay components

By addressing these technical considerations, researchers can design robust high-temperature biochemical assays that leverage the thermostability of TT_C0686 while accounting for the challenges associated with elevated temperature experiments.

How does TT_C0686 compare with other thermostable proteins from Thermus thermophilus in experimental applications?

Comparing TT_C0686 with other well-characterized thermostable proteins from Thermus thermophilus provides valuable context for experimental applications. The following comparative analysis highlights key similarities and differences:

Comparative Analysis of Thermostable T. thermophilus Proteins:

ProteinFunctionTemperature OptimumExperimental ApplicationsKey Properties
TT_C0686 (UPF0365/FloA)Membrane organization (putative)65-75°CStructural studies, membrane biologyFlotillin-like protein with potential membrane association
Tth RecADNA strand exchange65°CMultiplex PCR, elimination of non-specific PCR products"Effectively eliminates non-specific PCR products" and enables multiplex PCR
Tth DNA PolymeraseDNA synthesis70-80°CPCR, DNA sequencingHigh processivity, used in PCR applications
TthCsm ComplexRNA/DNA targeting65°CCRISPR applications, structural biology"Binds and cleaves complementary RNA at high temperatures" and "capable of robust ssDNA cleavage"

Methodological Insights from T. thermophilus Protein Research:

  • Temperature Requirements:

    • Studies with TthCsm complex demonstrate that "RNA cleavage was minimal at 37°C, but robust at 65°C"

    • Similarly, "The amount of RNA that was gel-shifted at 37°C was significantly less than at 65°C"

    • These findings suggest TT_C0686 would likely also show optimal activity at elevated temperatures

  • Reconstitution Strategies:

    • The successful approach used for TthCsm could be adapted for TT_C0686: "reconstituted a thermophilic Csm complex from T. thermophilus by co-overexpression of the Csm subunit proteins... in E. coli"

    • Expression in E. coli appears to be effective for producing functional thermostable proteins

  • Structural Biology Applications:

    • TthCsm complex "is amenable to negative stain EM analysis, making it an attractive candidate for structural studies using cryo-EM"

    • Similar approaches could be applied to TT_C0686, especially if its membrane association properties are preserved

Experimental Design Lessons from T. thermophilus Research:

  • PCR Applications:

    • Tth RecA research demonstrates that "multiplex PCR for as many as 14 sites can be done without significantly affecting the polymerization pattern"

    • This illustrates the robustness of T. thermophilus proteins in complex experimental systems

  • Binding and Activity Studies:

    • TthCsm research shows that "both RNA binding and cleavage by TthCsm are more efficient at high temperatures"

    • The paper hypothesizes that "The complex may be unable to undergo conformational changes necessary for target binding at lower temperatures"

    • Similar considerations likely apply to TT_C0686 activity and should inform experimental design

Understanding these comparative aspects allows researchers to adapt established methodologies from better-characterized T. thermophilus proteins to work effectively with TT_C0686 and to select appropriate experimental conditions that optimize protein performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.