Recombinant Thermus thermophilus UPF0365 protein TTHA1048 (TTHA1048)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
floA; TTHA1048; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Target Names
TTHA1048
Target Protein Sequence
MEGLGIVFLAAVVLLFVFLFFSFIPVGLWISAWAAGVRVPLLTLVAMRLRRVPPAKIIYP LIKATKAGLDVRLDRLEAHYLAGGNVDRVVDALIAADKAGIKLTFDRAAAIDLAGRDVLE AVRVSVNPKVIQTPMVAAVAKDGIQLLATARVTVRANIDRLVGGAGEETIIARVGEGIVT TIGSANSHKEVLENPDRISKTVLEKGLDAGTAFEILSVDIADVDVGKNIGAQLQIDQAEA DKKIAQAKAEERRAMAVAAEQENRALVEAMRAKLVEAQAQVPLALAEALRKGHLGVMDYY RLKNIEADTDMRESISRAAKPEGEE
Uniprot No.

Target Background

Function

Recombinant Thermus thermophilus UPF0365 protein TTHA1048 (TTHA1048) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered crucial regulators of membrane fluidity.

Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is TTHA1048 and what is its function in Thermus thermophilus?

TTHA1048 (UniProt ID: Q5SJG0) is annotated as a flotillin-like protein (FloA) involved in maintaining membrane fluidity and dynamism in Thermus thermophilus. It plays a critical role in the formation and function of fluid membrane microdomains (FMMs), which increase in number as bacterial cells age. These microdomains are essential for organizing membrane-associated processes, including cellular signaling and substrate transport.

The protein is particularly interesting due to its origin in T. thermophilus, an extreme-thermophilic bacterium capable of growing at temperatures ranging from 50°C to 83°C . This environmental adaptation suggests that TTHA1048 likely contributes to membrane stability under extreme temperature conditions.

How is recombinant TTHA1048 typically expressed and purified?

Recombinant TTHA1048 is typically expressed in heterologous systems, with E. coli being the most common expression host for research applications . The protein is often expressed with an N-terminal His-tag to facilitate purification through affinity chromatography .

Expression parameters:

ParameterDetails
Expression SystemE. coli (most common) or Yeast (for eukaryotic post-translational modifications)
TagHis-tag (N-terminal)
Protein LengthFull Length (1-325)
Purity>90% (via SDS-PAGE) or >85% (depending on production method)
FormLyophilized powder

For optimal solubility and yield, especially given the thermophilic nature of the protein, co-expression with thermophilic chaperones (e.g., GroEL/ES) may improve results as T. thermophilus proteins often misfold in mesophilic hosts like E. coli due to suboptimal temperatures.

What are the optimal storage conditions for recombinant TTHA1048?

For long-term stability, the following storage conditions are recommended:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, store in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles, as this may compromise protein integrity

  • For working aliquots, store at 4°C for up to one week

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

What methodologies are most effective for studying TTHA1048 interactions within membrane microdomains?

To effectively study TTHA1048 interactions within membrane microdomains, researchers should consider a multi-methodological approach:

  • Membrane Isolation and Fractionation:

    • Detergent-resistant membrane (DRM) isolation using cold non-ionic detergents

    • Density gradient centrifugation to separate membrane microdomains

    • Comparative analysis between different growth temperatures (50°C vs. 80°C) to assess temperature-dependent distribution patterns

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with antibodies against the His-tag

    • Cross-linking studies followed by mass spectrometry

    • Bacterial two-hybrid systems adapted for thermophilic conditions

    • Blue native PAGE to preserve native protein complexes

  • Fluorescence Microscopy:

    • Fluorescently tagged TTHA1048 (considering the impact of tags on function)

    • FRET analysis for protein proximity measurements

    • Super-resolution microscopy to visualize microdomain organization

  • Functional Assays:

    • Membrane fluidity assessments using fluorescent probes at various temperatures

    • Growth phenotype analysis of TTHA1048 deletion mutants at different temperatures

    • Complementation studies with mutant versions of TTHA1048

When reporting interaction studies, researchers should be attentive to potential contradictions in data that might arise from different methodological approaches and carefully validate findings using multiple techniques .

How can contradictions in experimental data relating to TTHA1048 function be identified and resolved?

When investigating TTHA1048 function, researchers may encounter contradictory data that requires systematic evaluation. Based on contradiction detection methodologies described in the search results , the following approach is recommended:

This structured approach can help researchers identify whether contradictions stem from biological variability, technical limitations, or fundamental misconceptions about TTHA1048 function .

What are the challenges in expressing thermophilic proteins like TTHA1048 in mesophilic host systems?

Expressing thermophilic proteins in mesophilic hosts presents several challenges that researchers must address:

  • Folding and Stability Issues:

    • T. thermophilus proteins often misfold in mesophilic hosts like E. coli due to suboptimal temperatures and missing chaperones

    • Proteins evolved for stability at high temperatures may aggregate or misfold at lower temperatures

  • Codon Usage Bias:

    • Differences in codon preference between thermophilic and mesophilic organisms can reduce expression efficiency

    • Codon optimization may be necessary for high-yield expression

  • Post-translational Modifications:

    • Temperature-dependent modifications observed in T. thermophilus (as seen with tRNA modifications ) may be absent in mesophilic hosts

    • Lack of specific modification enzymes in the host system

  • Experimental Solutions:

    • Co-expression with thermophilic chaperones (e.g., GroEL/ES) to improve folding

    • Expression at elevated temperatures (to the extent tolerated by the host)

    • Use of specialized expression strains with enhanced capacity for heterologous protein production

    • Alternative expression systems (e.g., yeast) that may provide more appropriate folding environments

  • Verification of Proper Folding:

    • Thermal stability assays

    • Circular dichroism to assess secondary structure

    • Activity assays at both mesophilic and thermophilic temperatures

How should bioassays be designed to accurately measure TTHA1048 activity?

Bioassays for TTHA1048 activity should be carefully designed considering its thermophilic origin and membrane-associated function:

  • Temperature Considerations:

    • Perform assays at multiple temperatures (25°C, 37°C, 60°C, 80°C) to assess temperature-dependent activity

    • Include appropriate controls at each temperature

    • Consider temperature ramping experiments to identify activity optima and thresholds

  • Membrane Association Assays:

    • Liposome association experiments with fluorescently labeled TTHA1048

    • Membrane fluidity measurements using appropriate fluorescent probes

    • Reconstitution in model membrane systems of varying lipid composition

  • Activity Quantification:

    • When applicable, calculate ED₅₀ values using the formula: 1 × 10⁶ / ED₅₀ (ng/mL) = specific activity (units/mg)

    • Determine activity in your specific functional assay system rather than relying solely on certificate of analysis data

  • Controls and Validation:

    • Use wild-type protein alongside mutant or tagged versions

    • Include proper negative controls (denatured protein, buffer-only)

    • Validate activity using multiple independent methods

  • Data Analysis:

    • Apply appropriate statistical methods for comparing activities under different conditions

    • Consider Michaelis-Menten kinetics if applicable to your activity assay

    • Report all experimental conditions in detail to ensure reproducibility

What are the best practices for ensuring recombinant TTHA1048 retains native functionality?

To ensure recombinant TTHA1048 maintains its native functionality, researchers should implement these best practices:

  • Expression Strategy Optimization:

    • Compare multiple expression systems (bacterial, yeast) to identify optimal conditions

    • Test different purification tags (His, MBP, GST) to determine minimal impact on function

    • Consider tag placement (N-terminal vs. C-terminal) based on protein topology

  • Purification Considerations:

    • Use gentle purification methods to maintain structural integrity

    • Include appropriate cofactors or stabilizing agents during purification

    • Verify purity (>90%) using SDS-PAGE and other analytical methods

  • Verification of Proper Folding:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to confirm expected thermostability

    • Limited proteolysis to verify compact, well-folded structure

  • Functional Validation:

    • Compare activity with native protein when possible

    • Assess temperature-dependent functionality

    • Verify membrane association characteristics

  • Storage and Handling:

    • Store according to recommended conditions (see Section 1.4)

    • Monitor stability over time with repeated activity assays

    • Document any loss of activity under various storage conditions

How can researchers differentiate between specific and non-specific effects when studying TTHA1048?

When investigating TTHA1048 function, distinguishing specific from non-specific effects requires rigorous experimental design and analysis:

  • Control Experiments:

    • Use multiple negative controls, including:

      • Empty vector/mock transfection controls

      • Inactive mutant versions of TTHA1048

      • Non-related proteins with similar physicochemical properties

    • Perform dose-response experiments to identify specific concentration thresholds

  • Specificity Validation:

    • Competition assays with unlabeled protein

    • Structure-function relationship studies with targeted mutations

    • RNA interference or CRISPR knockout studies in appropriate systems

  • Statistical Approaches:

    • Apply appropriate statistical tests to determine significance

    • Use multiple biological and technical replicates

    • Establish clear thresholds for what constitutes a significant effect

  • Data Visualization and Analysis:

    • Present data in formats that clearly distinguish signal from noise

    • Use appropriate normalization methods

    • Consider multivariate analysis when multiple parameters are measured

  • Reporting Standards:

    • Document all controls and validation experiments

    • Clearly state criteria for determining specificity

    • Acknowledge limitations in interpretation

What techniques can be used to study the role of TTHA1048 in T. thermophilus adaptation to extreme temperatures?

To investigate TTHA1048's role in temperature adaptation, researchers can employ these techniques:

  • Genetic Approaches:

    • Generate knockout/knockdown strains of TTHA1048 in T. thermophilus

    • Create point mutations in key functional domains

    • Perform complementation studies with wild-type or mutant TTHA1048

    • Analyze growth phenotypes across temperature ranges (50-83°C)

  • Biochemical and Biophysical Studies:

    • Membrane fluidity measurements at different temperatures using fluorescent probes

    • Differential scanning calorimetry to assess membrane transition temperatures

    • Proteomics analysis of membrane fraction composition at various temperatures

    • FRET-based assays to study protein-protein interactions at different temperatures

  • Comparative Studies:

    • Compare TTHA1048 with homologous proteins from mesophilic organisms

    • Analyze sequence and structural features that contribute to thermostability

    • Perform domain-swapping experiments between thermophilic and mesophilic homologs

  • Transcriptomic and Proteomic Approaches:

    • RNA-seq analysis to identify co-regulated genes across temperature ranges

    • Quantitative proteomics to measure temperature-dependent protein levels

    • Phosphoproteomics to identify regulatory modifications

  • Single-Cell Studies:

    • Fluorescence microscopy to visualize TTHA1048 localization at different temperatures

    • Microfluidic approaches to monitor real-time responses to temperature shifts

    • High-resolution imaging of membrane domain organization

This multi-faceted approach can help elucidate how TTHA1048 contributes to the remarkable temperature adaptability of T. thermophilus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.