Recombinant Theropithecus gelada Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)

Shipped with Ice Packs
In Stock

Description

Protein Overview

UQCRFS1 is a nuclear-encoded subunit of mitochondrial Complex III (cytochrome bc₁ complex), essential for oxidative phosphorylation. The recombinant version is expressed in E. coli with a His-tag for purification and experimental tracking . Key attributes include:

PropertyDetails
SpeciesTheropithecus gelada (Gelada baboon)
UniProt IDQ69BK2
Expression SystemEscherichia coli
Molecular Weight~30 kDa (mature protein: residues 79–274)
Amino Acid SequenceSHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYLVTAVTTVGVAYAAKNAVTQFIS... (274 residues total)
Purity>90% (SDS-PAGE verified)

Functional Role in Mitochondrial Respiration

UQCRFS1 is a catalytic core subunit of Complex III, enabling electron transfer from ubiquinol to cytochrome c₁ via a redox-driven Q-cycle mechanism . Key functions:

  • Electron Transport: Mediates transfer between ubiquinol (Q-pool) and cytochrome c₁, coupled with proton translocation .

  • Complex III Assembly: Incorporation of UQCRFS1 is the penultimate step in Complex III maturation, requiring chaperones like BCS1L and MZM1L .

Biochemical Interactions:

FunctionAssociated Proteins/Complexes
2Fe-2S cluster bindingMZM1L (LYRM7), BCS1L (assembly chaperones)
Ubiquinol oxidationCytochrome b (MT-CYB), Cytochrome c₁ (CYC1)

Research Applications

This recombinant protein is widely used in:

  • Enzyme Kinetics: Studying electron transfer mechanisms and proton pumping in isolated Complex III .

  • Structural Biology: Crystallography and cryo-EM to resolve conformational states during catalysis .

  • Disease Models: Investigating mitochondrial disorders linked to Complex III dysfunction (e.g., mutations in BCS1L or TTC19) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UQCRFS1; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
79-274
Protein Length
Full Length of Mature Protein
Species
Theropithecus gelada (Gelada baboon)
Target Names
Target Protein Sequence
SHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYLVTAVTTVGVAYAAKNAVTQFIS SMSASADVLAMAKIEINLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP QHDLDRVKKPEWVILIGICTHLGCVPIANAGDFGGYYCPCHGSHYDVSGRIRLGPAPLNL EVPPYEFTSDDMVVVG
Uniprot No.

Target Background

Function

Recombinant Theropithecus gelada Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) is a component of ubiquinol-cytochrome c oxidoreductase (Complex III), a multi-subunit transmembrane complex within the mitochondrial electron transport chain (ETC). The ETC drives oxidative phosphorylation, a crucial process for ATP synthesis. Complex III, along with succinate dehydrogenase (Complex II) and cytochrome c oxidase (Complex IV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase activity.

Complex III catalyzes electron transfer from ubiquinol to cytochrome c, coupling this redox reaction to proton translocation across the inner mitochondrial membrane via the Q cycle. This cycle consumes two protons from the matrix, releases four protons into the intermembrane space, and transfers two electrons to cytochrome c. The Rieske protein, a catalytic core subunit of Complex III, contains an iron-sulfur cluster essential for this electron transfer. UQCRFS1 undergoes post-translational processing upon incorporation into the Complex III dimer, yielding a fragment known as subunit 9 (corresponding to its mitochondrial targeting sequence, MTS). This processing is crucial for proper insertion into the complex. However, the persistence of UQCRFS1-derived fragments can hinder the processing and assembly of newly imported UQCRFS1, negatively impacting Complex III structure and function.

Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.