Recombinant Theropithecus gelada Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Cytochrome c Oxidase Subunit 2 (MT-CO2)

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of the mitochondrial electron transport chain, specifically within Complex IV. This enzyme plays a pivotal role in the process of oxidative phosphorylation, where it facilitates the transfer of electrons from cytochrome c to oxygen, ultimately contributing to the production of ATP, the primary energy currency of cells.

Structure and Function of MT-CO2

MT-CO2 is one of the three mitochondrial-encoded subunits of cytochrome c oxidase, alongside MT-CO1 and MT-CO3. These subunits are integral to the enzyme's function, which involves the reduction of oxygen to water, a process that drives the proton gradient necessary for ATP synthesis.

Assembly and Regulation of Cytochrome c Oxidase

The assembly of cytochrome c oxidase involves a complex series of steps, including the incorporation of mitochondrial-encoded subunits like MT-CO2, along with nuclear-encoded subunits and various co-factors. This process is highly regulated and involves numerous assembly factors that ensure the proper formation and function of the enzyme complex .

Relevance to Gelada Biology

While specific research on recombinant Theropithecus gelada MT-CO2 is lacking, studies on geladas have focused on their unique dietary adaptations and environmental responses. Geladas are graminivorous, primarily consuming grasses, which requires efficient digestive processes. Their gut microbiome adjusts seasonally to optimize nutrient extraction from their diet, reflecting adaptations to environmental variability .

Research Findings and Implications

Research on geladas highlights their ability to adapt to changing environmental conditions, such as shifts in rainfall and temperature, which affect their diet and energy metabolism . While not directly related to MT-CO2, these studies demonstrate the importance of understanding how environmental factors influence metabolic processes in geladas.

Environmental FactorImpact on Gelada Metabolism
RainfallInfluences gut microbiome composition, enhancing fermentative capabilities during wet periods .
TemperatureAffects energy metabolism, with increased activity in cold and dry periods .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Theropithecus gelada (Gelada baboon)
Target Names
Target Protein Sequence
MAHPVQLGLQDATSPVMEELVTFHDHALMAMFLISFLILYALSATLTTKLTNTNITDAQE METIWTILPAVILVLIALPSLRILYMTDEINNPSFTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLNPGDLRLLEVDNRVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLN QTVFTATRPGVYYGQCSEICGANHSFMPIVAELIPLKIFEMGPVFTL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a crucial component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. Within Complex IV, MT-CO2 contributes to the dinuclear copper A center (CuA) and facilitates electron transfer from reduced cytochrome c (in the intermembrane space) to the binuclear center (BNC). The BNC, comprised of heme a3 and copper B (CuB), catalyzes the reduction of oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.