Recombinant Thioalkalivibrio sp. Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Thioalkalivibrio sp. Electron Transport Complex Protein RnfE (rnfE)

Recombinant Thioalkalivibrio sp. Electron Transport Complex Protein RnfE (rnfE) is a bioengineered version of the native RnfE protein, a subunit of the Rnf complex, which functions as an ion-motive electron transport system in chemolithoautotrophic bacteria. This protein is critical for coupling ferredoxin to pyridine nucleotides (e.g., NAD+/NADH) and plays a role in sulfur oxidation and energy metabolism in haloalkaliphilic environments . The recombinant form is typically expressed in E. coli and purified for biochemical and biotechnological studies .

Electron Transport and Sulfur Oxidation

The Rnf complex, including RnfE, operates as a sodium-driven electron transport system, coupling ferredoxin oxidation to NAD+ reduction in Thioalkalivibrio species . It is integral to:

  1. Sulfur Oxidation Pathways: RnfE interacts with sulfur transferases (e.g., TusA, DsrE) to shuttle sulfur intermediates to heterodisulfide reductase-like (sHdr) complexes .

  2. Energy Metabolism: In chemolithoautotrophic bacteria, RnfE facilitates proton/sodium gradients to drive ATP synthesis .

Genomic Distribution

RnfE is conserved in Thioalkalivibrio genomes, particularly in strains with the reverse dissimilatory sulfate reduction (rDSR) pathway . For example:

Thioalkalivibrio StrainRnfE PresenceAssociated PathwaysSource
Tv. jannaschii ALM2TYesrDSR, sulfur oxidation
Tv. thiocyanoxidans ARh2TYesTcDH, Apr-Sat pathways
Tv. paradoxus ARh1TYesSOR, sulfur oxygenase/reductase

Recombinant Production

RnfE is expressed in E. coli with optimized protocols:

  • Expression Vector: Typically cloned into vectors with T7 promoters (e.g., pET series) .

  • Purification: Affinity chromatography via His-tag, followed by size-exclusion chromatography .

  • Stability: Lyophilized storage at -20°C/-80°C recommended; repeated freeze-thaw cycles avoided .

Research and Biotechnological Use

  1. Structural Studies: Used to elucidate Rnf complex architecture and ion-translocating mechanisms .

  2. Enzymatic Assays: Tested for electron transfer activity with ferredoxin and NAD+ analogs .

  3. Sulfur Cycling Research: Investigated in models of microbial sulfur oxidation and thioarsenate metabolism .

Transcriptomic and Proteomic Data

In arsenic-stressed Thioalkalivibrio species, RnfE expression is linked to:

  • Arsenic Detoxification: Co-regulated with sulfur oxidation genes (e.g., soeABC, aprBA) .

  • Stress Response: Upregulation of heat shock proteins (e.g., dnaK, groEL) during arsenite exposure .

Phylogenetic and Functional Evolution

  • Evolutionary Conservation: RnfE clusters with homologs from Thioalkalivibrio and Acidihalobacteraceae, indicating ancient origins in sulfur-oxidizing bacteria .

  • Functional Divergence: Variants in RnfE subunits may enable adaptation to different electron donors/acceptors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfE; Tgr7_2631; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Target Names
Tgr7_2631
Target Protein Sequence
MSDISYREINANGFWHNNPGLVQLLGLCPLLAISGTVVNALGLGLATTLTLVASNVTVSL IRHWVRPEIRIPVFVLIIASVVTAIELAMNAFFHELYLILGIFIPLIVTNCAIIGRAEAF ASKQPIPKALADGLAMGLGFTCVLVALGALREAVGHGTLLADAHLMFGEAARGFSLTLFE EYRGFLLALLPPGAFIALGLLIALKNIIDARLQKRQPAQAAVPVEAAG
Uniprot No.

Target Background

Function
A component of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the RnfE protein and what is its role in Thioalkalivibrio species?

RnfE is a subunit of the Rnf (Rhodobacter nitrogen fixation) complex, which functions as a membrane-bound electron transport system in many bacteria including Thioalkalivibrio species. The Rnf complex likely plays a critical role in energy conservation during chemolithoautotrophic growth of these extremophilic bacteria. While not explicitly characterized in the search results, the Rnf complex typically couples electron transfer between NADH and ferredoxin to ion translocation across the membrane, contributing to the generation of a proton motive force that can drive ATP synthesis.

In Thioalkalivibrio, which are obligately chemolithoautotrophic bacteria found in soda lakes with pH >9 and moderate to high salinity, electron transport systems are particularly important for energy conservation during the oxidation of reduced sulfur compounds .

How does Thioalkalivibrio adapt to extreme environments, and what role might electron transport proteins play?

Thioalkalivibrio species have adapted to thrive in extreme soda lake environments characterized by high pH (>9) and moderate to extremely high salinity. Despite these harsh conditions, these bacteria maintain highly active biogeochemical cycling, particularly of sulfur compounds .

The electron transport systems, potentially including the Rnf complex containing RnfE, are likely crucial for these adaptations as they:

  • Enable energy conservation during chemolithoautotrophic growth on reduced sulfur compounds

  • May contribute to maintaining intracellular pH homeostasis through proton/sodium translocation

  • Could participate in redox balancing under extreme conditions

Genomic analysis has shown that all 75 sequenced Thioalkalivibrio strains possess flavocytochrome c (fcc), a truncated sox system, and sulfite:quinone oxidoreductase (soe), revealing the importance of diverse electron transport mechanisms in these extremophiles .

What expression systems are recommended for recombinant Thioalkalivibrio proteins?

While specific expression systems for Thioalkalivibrio RnfE are not directly mentioned in the search results, principles from other recombinant protein expression studies can be applied. For extremophilic proteins like those from Thioalkalivibrio, consider the following approaches:

  • E. coli-based expression systems: These are often the first choice due to their well-established protocols and rapid growth. When using E. coli for extremophilic proteins, optimization of culture conditions is essential, including:

    • Temperature modulation (typically lower temperatures for improved folding)

    • Media composition adjustments

    • Induction timing and inducer concentration

  • Experimental design approach: As demonstrated for pneumolysin expression, a statistical experimental design methodology evaluating multiple variables simultaneously can significantly improve soluble protein yields. This approach can identify optimal conditions while minimizing the number of experiments needed .

For membrane proteins like RnfE, additional considerations include the use of specialized E. coli strains or alternative hosts that better accommodate membrane protein expression.

How can I optimize expression conditions for recombinant Thioalkalivibrio RnfE protein?

Optimization of recombinant RnfE expression requires a systematic approach evaluating multiple variables simultaneously. Based on successful strategies for other recombinant proteins, consider the following methodology:

  • Multivariate statistical experimental design: Implement a fractional factorial design rather than the traditional one-variable-at-a-time approach. This allows assessment of multiple variables and their interactions simultaneously, providing comprehensive information with fewer experiments .

  • Key variables to evaluate:

    • Induction temperature (typically 16-37°C)

    • Inducer concentration

    • Induction time (optimal time for highest productivity with lowest operational time, often 4-6 hours for many proteins)

    • Media composition (carbon source, nitrogen source, salt concentration)

    • Cell density at induction

  • Response metrics:

    • Total protein yield

    • Soluble fraction percentage

    • Functional activity

    • Cell growth

Table 1: Example of factorial design variables for optimizing RnfE expression

VariableLow level (-1)Center point (0)High level (+1)
Temperature (°C)182530
IPTG (mM)0.10.51.0
Induction time (h)4816
Cell density at induction (OD600)0.61.01.5
NaCl concentration (%)012

This approach has successfully yielded high levels (250 mg/L) of soluble functional recombinant protein in other systems .

What purification strategies are most effective for recombinant RnfE from Thioalkalivibrio species?

Purification of membrane proteins like RnfE requires specialized approaches:

  • Membrane fraction isolation:

    • Cell disruption via sonication or high-pressure homogenization in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fractions (10,000-15,000g for cell debris removal, followed by 100,000-150,000g for membrane collection)

  • Solubilization:

    • Screen multiple detergents for optimal extraction efficiency while maintaining protein functionality

    • Commonly effective detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin

    • Gentle solubilization at 4°C with controlled detergent:protein ratios

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Ion-exchange chromatography based on the predicted isoelectric point

    • Size exclusion chromatography as a polishing step

Throughout the purification process, maintain conditions that mimic the natural environment of Thioalkalivibrio (alkaline pH, moderate salt) to promote protein stability, while keeping temperatures low (4°C) to minimize degradation.

How can I assess the electron transport function of recombinant RnfE in vitro?

To evaluate the electron transport function of recombinant RnfE:

  • Reconstitution into liposomes or nanodiscs:

    • Prepare liposomes with lipid compositions mimicking Thioalkalivibrio membranes

    • Incorporate purified RnfE using detergent removal techniques (dialysis, Bio-Beads, or cyclodextrin)

    • Verify orientation using protease protection assays

  • Electron transport activity assays:

    • Monitor electron transfer between NADH and ferredoxin spectrophotometrically

    • Track proton/sodium translocation using pH-sensitive fluorescent dyes or radiolabeled ion uptake

    • Measure membrane potential generation using voltage-sensitive dyes

  • Redox potential determination:

    • Protein film voltammetry to determine the midpoint potentials of redox centers

    • EPR spectroscopy to characterize the iron-sulfur clusters

The relationship between electron transport and proton/sodium translocation can provide insights into the energy conservation mechanisms in extremophilic Thioalkalivibrio species.

How does arsenite stress affect the expression and function of electron transport proteins in Thioalkalivibrio?

Arsenite stress significantly impacts electron transport systems in Thioalkalivibrio species, with different responses observed between species:

In Tv. jannaschii ALM2 T (resistant to 5 mM arsenite) and Tv. thiocyanoxidans ARh2 T (resistant only to 0.1 mM arsenite), arsenite exposure led to differential expression of several electron transport components:

  • Upregulation of specific electron transport genes:

    • Tv. thiocyanoxidans ARh2 T upregulated sox genes (soxYZXXAB) involved in sulfur oxidation under arsenite stress

    • Both species showed upregulation of the "Soe-like" gene (cluster 2 SoeABC), which may be involved in both sulfur oxidation and arsenite detoxification

    • Molybdenum cofactor production genes (moaA) and molybdate transporters were upregulated in Tv. jannaschii ALM2 T, essential for the function of certain oxidoreductases

  • Potential functional adaptation:

    • Both species oxidized arsenite to arsenate aerobically despite Tv. thiocyanoxidans lacking known arsenite oxidases

    • The connection between arsenite stress and electron transport suggests that modification of electron flow patterns may be a stress response mechanism

This information highlights how electron transport proteins like RnfE may be integrated into broader stress response networks in extremophilic bacteria.

What is the relationship between sulfur oxidation and electron transport in Thioalkalivibrio, and how might RnfE be involved?

Thioalkalivibrio species possess diverse sulfur oxidation pathways that are tightly linked to electron transport systems:

  • Core sulfur oxidation systems present across all strains:

    • Flavocytochrome c (fcc)

    • Truncated sox system

    • Sulfite:quinone oxidoreductase (soe)

  • Variable sulfur oxidation pathways:

    • Dissimilatory sulfite reductase (dsr) present in only 6 out of 75 strains

    • Heterodisulfide reductase system (hdr) detected in 73 genomes, proposed to oxidize sulfur to sulfite in strains lacking both dsr and soxCD

The RnfE protein as part of the Rnf complex may participate in this metabolic network by:

  • Providing reducing equivalents necessary for carbon fixation

  • Maintaining redox balance during sulfur compound oxidation

  • Contributing to proton motive force generation for ATP synthesis

Interestingly, hierarchical clustering of Thioalkalivibrio strains based on sulfur gene repertoire showed close correlation with phylogenomic analysis, suggesting co-evolution of these systems .

How can I overcome solubility issues when expressing recombinant RnfE protein?

Membrane proteins like RnfE often face solubility challenges during recombinant expression. Implement these strategies to improve solubility:

  • Expression condition optimization:

    • Lower induction temperatures (16-20°C) to slow protein synthesis and improve folding

    • Reduce inducer concentration to decrease expression rate

    • Use rich media formulations with osmolytes that can stabilize protein structure

  • Genetic modifications:

    • Create fusion constructs with solubility-enhancing partners (MBP, SUMO, Trx)

    • Express individual domains separately if the full-length protein proves challenging

    • Consider codon optimization for the expression host

  • Host selection:

    • Test alternative expression hosts with different membrane compositions

    • Use specialized E. coli strains with modified membrane properties or additional chaperones

For RnfE specifically, consider that the protein functions in alkaliphilic Thioalkalivibrio strains. Adjusting the expression conditions to reflect aspects of this environment (higher pH, presence of sodium ions) may improve proper folding and membrane insertion.

What approaches can be used to study the interaction between RnfE and other components of the electron transport complex?

To investigate the interactions between RnfE and other components of the electron transport complex:

These approaches can reveal how RnfE contributes to the structure and function of the electron transport complex in Thioalkalivibrio species.

How might RnfE function differ between Thioalkalivibrio species with different ecological adaptations?

The genus Thioalkalivibrio shows remarkable diversity in ecological adaptations, which may be reflected in functional differences of electron transport proteins like RnfE:

  • Species-specific adaptations:

    • Tv. jannaschii ALM2 T (isolated from arsenic-rich Mono Lake) shows high arsenite resistance (up to 5 mM)

    • Tv. thiocyanoxidans ARh2 T (isolated from Kenyan soda lakes) has lower arsenite tolerance (0.1 mM) but possesses thiocyanate oxidation capabilities

    • Different species show distinct genomic repertoires of sulfur oxidation genes

  • Potential RnfE functional variations:

    • RnfE may have evolved different coupling efficiencies or ion specificities (H+ vs. Na+) depending on the species' environmental niche

    • Amino acid substitutions might alter redox potentials or substrate affinities to match ecological requirements

    • Regulatory differences could result in variable expression levels under specific stressors

  • Research approach to investigate differences:

    • Comparative sequence analysis of RnfE across Thioalkalivibrio species

    • Heterologous expression and functional characterization of RnfE variants

    • Site-directed mutagenesis to identify functionally important residues

This research direction could provide insights into how electron transport components evolve to support microbial adaptation to extreme environments.

How does reverse electron transport function in Thioalkalivibrio, and what role might RnfE play?

Reverse electron transport (RET) is a process where electrons flow against the thermodynamic gradient, consuming rather than generating proton motive force. In Thioalkalivibrio:

  • Potential mechanisms of RET in Thioalkalivibrio:

    • RET likely occurs during growth on reduced sulfur compounds with high-potential electron acceptors

    • The process may be crucial for generating reducing equivalents (NADH) needed for CO2 fixation

    • RET can also be a source of reactive oxygen species (ROS) that may function in signaling

  • RnfE's possible role in RET:

    • As part of the Rnf complex, RnfE might participate in bidirectional electron transfer

    • Under certain conditions, the Rnf complex could potentially operate in reverse, using proton motive force to drive unfavorable electron transfer reactions

    • This function could be particularly important in an obligate chemolithoautotroph like Thioalkalivibrio

  • RET and ROS signaling:

    • RET is sensitive to changes in the CoQ redox state and variations in membrane potential (Δp)

    • RET-derived ROS could serve as signals that indicate metabolic status

    • These signals may trigger adaptive responses to changing environmental conditions

Understanding the role of RnfE in potential RET processes could provide insights into how Thioalkalivibrio species manage their energy budget in extreme environments.

What computational approaches can predict structure-function relationships in RnfE and guide protein engineering efforts?

Modern computational methods offer powerful tools for predicting structure-function relationships in proteins like RnfE:

  • Structural prediction approaches:

    • AlphaFold2 or RoseTTAFold for accurate prediction of protein tertiary structure

    • Molecular dynamics simulations to assess stability and conformational changes

    • Computational docking to predict interactions with other Rnf complex components

  • Functional site identification:

    • ConSurf analysis to identify evolutionarily conserved residues

    • Electrostatic surface mapping to identify potential ion and electron transfer pathways

    • Machine learning approaches trained on known electron transport proteins to predict functional sites

  • Rational design strategies:

    • In silico mutagenesis to predict the impact of amino acid substitutions

    • Design of chimeric proteins incorporating domains from different Thioalkalivibrio species

    • Computational screening of stability-enhancing mutations

Table 2: Computational tools for RnfE analysis

Analysis typeRecommended toolsApplication to RnfE
Structure predictionAlphaFold2, RoseTTAFoldPredicting membrane topology and cofactor binding sites
Molecular dynamicsGROMACS, NAMDSimulating behavior in membrane environment
Evolutionary analysisConSurf, CAPSIdentifying co-evolving residues within Rnf complex
ElectrostaticsAPBS, DelPhiMapping potential electron transfer pathways
Protein engineeringRosetta, FoldXDesigning variants with enhanced stability

These computational approaches can guide experimental efforts to understand and engineer RnfE proteins with desired properties for both fundamental research and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.