Recombinant Thioalkalivibrio sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

PlsY is encoded by the plsY gene (locus tag: Tgr7_3015) in Thioalkalivibrio sulfidiphilus strain HL-EbGR7. The recombinant form is expressed in mammalian cells or baculovirus systems, yielding partial-length proteins (amino acids 1–203) with >85% purity . Key features include:

  • UniProt ID: B8GPT8

  • Molecular Weight: Determined via SDS-PAGE, though exact mass is unspecified in available data.

  • Tag Information: Variable tags (e.g., His-tag) may be added during production .

  • Sequence: Includes conserved motifs for acyltransferase activity (e.g., HX4D) .

Enzymatic Activity and Biological Role

PlsY catalyzes the first committed step of the glycerol phosphate pathway, transferring an acyl group to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA) . Unlike eukaryotic GPATs that primarily acylate the sn-1 position, bacterial PlsY may favor sn-2 acylation, a trait observed in plant homologs like GPAT4/6 . This positional specificity influences membrane lipid architecture, critical for Thioalkalivibrio’s survival in extreme environments (e.g., high pH, salinity) .

Key Functional Insights:

  • Substrate Specificity: Utilizes acyl-phosphate donors .

  • Thermostability: Retains activity under high sodium/potassium concentrations (up to 4 M Na⁺) .

  • Regulation: Co-expressed with fatty acid desaturases (fabA) under low-temperature stress, suggesting adaptive lipid remodeling .

Industrial and Research Applications

Recombinant PlsY is pivotal for:

  1. Lipid Metabolism Studies: Investigating prokaryotic glycerolipid biosynthesis pathways .

  2. Bioremediation: Thioalkalivibrio spp. oxidize sulfide in alkaline wastewater; PlsY-derived membrane lipids enhance stress resilience in bioreactors .

  3. Enzyme Engineering: Structure-function analyses to optimize acyltransferase activity for synthetic biology .

Table 2: GPAT Family Enzymes Across Species

OrganismGPAT TypeAcylation PositionKey Feature
Thioalkalivibrio sp.PlsYsn-2 (putative)Haloalkaliphilic adaptation
Arabidopsis thalianaGPAT4/6sn-2Cutin biosynthesis
Saccharomyces cerevisiaeGpt2psn-1Membrane lipid synthesis

Future Directions

Further studies should resolve PlsY’s crystal structure to clarify its sn-2 preference and engineer thermostable variants for industrial biocatalysis. Comparative genomics of Thioalkalivibrio strains (e.g., K90mix, 10fs10) may reveal evolutionary adaptations in lipid metabolism .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
plsY; Tgr7_3015; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Target Names
plsY
Target Protein Sequence
MLLASALVLGAYLLGSVSTAILVCRLAGLPDPRSQGSGNPGATNVLRTGRKGAAIITLLG DLLKGLVPVLVAHALGLEPVWIAAVALAAFLGHLFPVYHGFRGGKGVATALGVILGIQAW VGLAALATWLIVAAISRISSLSALTAATLTPVYMYLLTGERWYVAAGVLLAALIYWRHRA NIRRLLRGEEPKIGNKTKNKSEV
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Glycerol-3-phosphate acyltransferase (plsY) in Thioalkalivibrio species?

Glycerol-3-phosphate acyltransferase (plsY) in Thioalkalivibrio species catalyzes the first and rate-limiting step of glycerolipid biosynthesis by transferring acyl groups from acylphosphate to glycerol-3-phosphate, producing lysophosphatidic acid (LPA). This reaction is fundamental in bacterial membrane phospholipid biosynthesis and represents the most widely distributed biosynthetic pathway to initiate phosphatidic acid formation. In the bacterial acylphosphate pathway, PlsX converts acyl-acyl carrier protein to acylphosphate, and PlsY subsequently transfers the acyl group from acylphosphate to glycerol-3-phosphate .

How does the membrane topology of plsY influence its enzymatic function?

The membrane topology of plsY significantly impacts its enzymatic function through its distinctive architectural arrangement. Studies on related acyltransferases (such as in Streptococcus pneumoniae) reveal that plsY contains five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane. Each of the three larger cytoplasmic domains contains a highly conserved sequence motif critical for catalysis. This topology creates an environment where:

  • Motif 1 contains essential serine and arginine residues for substrate recognition

  • Motif 2 functions as a phosphate-binding loop, corresponding to the glycerol-3-phosphate binding site

  • Motif 3 contains conserved histidine and asparagine residues important for activity, plus a glutamate critical to structural integrity

This membrane orientation allows plsY to efficiently coordinate the transfer of acyl groups from acylphosphate to glycerol-3-phosphate within the bacterial cell membrane environment .

What are the optimal storage conditions for recombinant Thioalkalivibrio sp. plsY protein?

For recombinant Thioalkalivibrio sp. plsY protein, optimal storage conditions include:

  • Storage temperature: -20°C for routine storage; -80°C for extended preservation

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Handling practices: Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • Working aliquots: Store at 4°C for up to one week

  • Shelf life: Liquid form typically maintains stability for 6 months at -20°C/-80°C; lyophilized form remains stable for 12 months at -20°C/-80°C

For reconstitution of lyophilized protein, it is recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage)

  • Aliquot for long-term storage at -20°C/-80°C

What expression systems are most effective for producing recombinant Thioalkalivibrio sp. plsY?

The production of functional recombinant Thioalkalivibrio sp. plsY requires careful selection of expression systems, with mammalian cell-based expression systems being particularly effective according to current research. This approach offers several advantages:

Expression SystemAdvantagesLimitationsTypical Yield
Mammalian cellsProper post-translational modifications, correct folding, high solubilityHigher cost, longer production timeGood for structural studies (>85% purity by SDS-PAGE)
E. coliRapid growth, high protein yields, cost-effectiveMay form inclusion bodies, improper foldingVariable, often requires optimization
Insect cellsBetter folding than bacterial systems, some post-translational modificationsMore complex than bacterial systemsModerate to high

For optimal expression, considerations should include:

  • Codon optimization for the chosen expression system

  • Addition of appropriate affinity tags (determined during the production process)

  • Selection of suitable induction conditions

  • Inclusion of appropriate chaperones when necessary to assist folding

The choice of expression system should be guided by the intended experimental application, with mammalian systems being preferred when highly purified, properly folded protein is essential for functional studies .

What mechanisms regulate the enzymatic activity of plsY under different environmental conditions?

The enzymatic activity of plsY in Thioalkalivibrio species is regulated by several mechanisms that respond to environmental conditions:

  • Temperature adaptation: Studies on related Thioalkalivibrio strains reveal significant adaptation of membrane lipid composition at different temperatures. At lower temperatures (10°C), there is upregulation of the fatty acid desaturase pathway, particularly the fabA gene, which likely affects substrate availability for plsY and subsequently influences its activity by altering membrane fluidity .

  • pH and salinity effects: As haloalkaliphilic bacteria, Thioalkalivibrio species thrive in high pH and salinity environments. These conditions impact plsY activity through:

    • Modification of membrane lipid composition (increased phosphatidylcholine content)

    • Altered substrate availability and enzyme conformation

    • Changes in the protein's interaction with the membrane environment

  • Substrate-based regulation: plsY activity is noncompetitively inhibited by palmitoyl-CoA, suggesting a feedback mechanism that helps regulate glycerolipid biosynthesis rates based on fatty acid availability .

  • Oxidative stress response: Under oxidative stress conditions (such as arsenite exposure), Thioalkalivibrio species show upregulation of various stress response pathways that may indirectly affect plsY activity through altered membrane composition and energetics .

These regulatory mechanisms allow plsY to maintain optimal activity across the extreme conditions where Thioalkalivibrio species naturally thrive, including soda lakes with high pH, salinity, and variable temperatures .

How can recombinant Thioalkalivibrio sp. plsY be utilized in inhibitor design for antimicrobial development?

Recombinant Thioalkalivibrio sp. plsY can serve as a valuable model for the design and screening of antimicrobial inhibitors through several strategic approaches:

  • Structure-based inhibitor design: The conserved catalytic motifs in plsY (particularly the three essential domains) provide excellent targets for rational drug design. Research has shown that benzoic acids and phosphonic acids with saturated alkyl sulfonamides can target the glycerol-3-phosphate binding pocket, which contains conserved positively charged amino acids that interact with the phosphate group. Compounds like 2-(nonylsulfonamido)benzoic acid have demonstrated moderate GPAT inhibitory activity .

  • High-throughput screening platforms: Recombinant plsY can be utilized in enzymatic assays to screen compound libraries for inhibitory activity. The acylation reaction between 14C-labelled glycerol-3-phosphate and palmitoyl-CoA can be measured by scintillation counting to identify effective inhibitors .

  • Comparative analysis across bacterial species: Targeting the conserved features while exploiting subtle differences between plsY from different bacterial species can lead to species-specific inhibitors, potentially addressing antibiotic resistance issues.

Inhibition of plsY is particularly promising for antimicrobial development because:

  • It catalyzes the rate-limiting step in glycerolipid biosynthesis

  • It's essential for bacterial membrane formation

  • The structural features of its active site are conserved across bacterial species but differ from mammalian counterparts

These characteristics make Thioalkalivibrio sp. plsY an excellent model for developing antimicrobials that could disrupt bacterial membrane synthesis pathways .

What role does recombinant plsY play in understanding bacterial adaptation to extreme environments?

Recombinant plsY serves as a critical molecular probe for understanding bacterial adaptation to extreme environments, particularly for haloalkaliphilic bacteria like Thioalkalivibrio species that thrive in soda lakes with high pH and salinity. This enzyme provides several insights:

  • Membrane lipid adaptation mechanisms: By studying recombinant plsY enzymatic activity under various conditions (temperature, pH, salinity), researchers can understand how these bacteria modify their membrane composition to maintain cellular integrity in extreme environments. For example, in Thioalkalivibrio strains, membrane adaptation to low temperature (10°C) involves increased expression of fatty acid desaturases and changes in phospholipid head group composition, which directly involve plsY activity .

  • Evolutionary adaptation markers: Comparative analysis of plsY sequence and function across different Thioalkalivibrio species from various geographical locations can reveal evolutionary adaptations. For instance, Thioalkalivibrio versutus AL2T from soda lakes in southeast Siberia shows distinct adaptations to seasonal temperature variations compared to other strains .

  • Stress response pathways: Research has shown that under stress conditions (such as arsenite exposure), Thioalkalivibrio species exhibit changes in gene expression that affect membrane composition. For example, Tv. jannaschii ALM2T can resist up to 5 mM arsenite, while Tv. thiocyanoxidans ARh2T can only tolerate 0.1 mM. Understanding how plsY function is maintained or modified under such stress provides insights into bacterial resilience mechanisms .

These applications have broader implications for understanding microbial adaptation to extreme environments, potentially informing synthetic biology approaches for engineering organisms with enhanced environmental tolerance .

How does the function of plsY in Thioalkalivibrio sp. compare with GPAT enzymes from other organisms in the production of DHA-rich glycerolipids?

The function of plsY in Thioalkalivibrio sp. presents interesting comparative insights when examined alongside GPAT enzymes from other organisms, particularly regarding the production of DHA-rich glycerolipids:

OrganismEnzymeSubstrate SpecificityDHA IncorporationKey Functional Differences
Thioalkalivibrio sp.plsYAcylphosphate to G3PLimited information availableMembrane-bound, requires PlsX for acylphosphate production
Aurantiochytrium limacinumPLAT2Preferentially transfers DHA to G3PHigh - produces LPA 22:6, which develops into DHA-rich glycerolipidsSpecialized for DHA incorporation, directly impacts production of multiple DHA-containing lipids
MammalsGPAT1-4Various preferences, GPAT1 prefers saturated acyl-CoAsVariable depending on isoformMultiple isoforms with tissue-specific expression and distinct subcellular locations

The critical functional differences include:

  • Substrate utilization pathway: Thioalkalivibrio plsY utilizes acylphosphate generated by PlsX, while PLAT2 in Aurantiochytrium directly incorporates DHA to G3P, producing lysophosphatidic acid with DHA (LPA 22:6), which serves as a precursor for DHA-rich glycerolipids .

  • Impact on downstream lipid production: Overexpression of PLAT2 in Aurantiochytrium increases production of:

    • Two DHA-containing diacylglycerol (DG 44:12)

    • Three DHA-containing triacylglycerol (TG 66:18)

    • Two DHA-containing triacylglycerol (TG 60:12)

    • Two DHA-containing phosphatidylcholine (PC 44:12)

This specialized function in producing DHA-rich lipids contrasts with the more general role of bacterial plsY in membrane phospholipid synthesis .

  • Evolutionary specialization: The differences reflect evolutionary adaptations to distinct ecological niches and metabolic requirements, with Thioalkalivibrio optimized for extreme environments versus Aurantiochytrium specialized for DHA production .

These comparative insights provide valuable perspectives for understanding the evolutionary divergence of GPAT enzymes and their specialized roles in different organisms .

What approaches can be used to investigate the role of plsY in co-cultures of different Thioalkalivibrio species under environmental stress conditions?

Investigating the role of plsY in co-cultures of different Thioalkalivibrio species under environmental stress requires sophisticated methodological approaches that combine molecular, biochemical, and ecological techniques:

These methodologies enable comprehensive understanding of how plsY contributes to the remarkable adaptability of Thioalkalivibrio species in extreme environments and their population dynamics in mixed communities .

How might genetic modification of plsY in Thioalkalivibrio sp. be utilized to enhance biodesulfurization processes?

Genetic modification of plsY in Thioalkalivibrio species presents promising opportunities for enhancing biodesulfurization processes through several strategic approaches:

  • Membrane optimization for sulfur metabolism:

    • Targeted modifications of plsY could alter membrane lipid composition to enhance cellular resistance to sulfur compounds

    • Engineering plsY to function optimally at higher concentrations of sulfur intermediates could improve the efficiency of thiosulfate oxidation pathways

    • Modified membrane properties could enhance oxygen transfer rates, which is critical since Thioalkalivibrio species perform biodesulfurization via oxygen-dependent pathways

  • Enhancing cellular tolerance to process conditions:

    • Engineered plsY variants could stabilize membrane integrity under the extreme pH and salt conditions typical of biodesulfurization processes

    • Modifications targeting the enzyme's temperature sensitivity could expand the operational range of biodesulfurization systems

    • Specifically designed mutations in plsY's catalytic domains could alter membrane fluidity to optimize cellular function in airlift bioreactors

  • Integration with microbubble technologies:
    Research has demonstrated that microbubble strategies significantly enhance biodesulfurization performance by Thioalkalivibrio species. Engineered plsY could contribute to this by:

    • Modifying membrane properties to optimize interaction with microbubbles

    • Enhancing cellular resistance to shear stress experienced in airlift bioreactors

    • Improving oxygen utilization efficiency during the biodesulfurization process

  • Potential experimental design for validation:

Modification ApproachExpected EffectMeasurement ParametersApplication Potential
Site-directed mutagenesis of substrate binding regionsAltered specificity for different acyl donorsMembrane composition analysis, growth rates in sulfur mediaCustomized membranes for specific sulfur compounds
Expression level modificationChanged membrane lipid turnover ratesOxygen consumption rates, thiosulfate conversion efficiencyProcess optimization for industrial applications
Chimeric enzymes combining domains from different speciesNovel membrane propertiesCellular tolerance to extreme conditions, long-term stabilityEnhanced biodesulfurization in challenging environments

These approaches could significantly advance the application of Thioalkalivibrio species in environmental biotechnology, particularly in treating sulfur-containing industrial waste gases .

What are the potential implications of current recombinant DNA technology advancements for studying plsY function across extremophilic bacteria?

Current advancements in recombinant DNA technology offer transformative opportunities for studying plsY function across extremophilic bacteria, with several important implications:

  • CRISPR-Cas9 genome editing applications:
    The development of CRISPR systems has revolutionized genetic manipulation possibilities for extremophiles. For plsY research, this enables:

    • Precise gene editing to create knockout, knockdown, or modified expression lines in previously intractable extremophilic bacteria

    • Sequential modification of multiple genes in metabolic pathways connected to plsY function

    • Targeted promoter modifications to study regulation of plsY expression under extreme conditions

    These capabilities address previous limitations in genetic manipulation of extremophiles, allowing researchers to directly test hypotheses about plsY function in native contexts .

  • Synthetic biology approaches:
    Advanced recombinant DNA techniques enable:

    • Creation of chimeric plsY proteins combining domains from different extremophiles to investigate structure-function relationships

    • Development of synthetic minimal genomes with redesigned membrane synthesis pathways

    • Biosensor development using plsY-regulated elements to monitor membrane stress in real-time

    These approaches provide unprecedented tools for understanding the fundamental principles of membrane adaptation in extreme environments .

  • Heterologous expression systems:
    Improvements in expression technologies facilitate:

    • Functional expression of extremophile plsY variants in model organisms for comparative biochemical studies

    • Creation of reporter systems to monitor activity under varying conditions

    • High-throughput screening of environmental samples for novel plsY variants with unique properties

    These technologies enable the functional characterization of plsY from unculturable extremophiles or from metagenome samples .

  • Integrative omics approaches:
    Modern recombinant DNA technology combined with multi-omics provides:

    • Correlation of plsY sequence variations with functional differences across extremophile taxa

    • Systems-level understanding of plsY's role in cellular adaptation networks

    • Prediction of evolutionary trajectories and adaptation mechanisms in changing environments

    This integration provides a comprehensive view of how plsY contributes to extremophile adaptation at multiple biological levels .

These advances collectively expand our understanding of membrane adaptation mechanisms in extremophiles, with potential applications in synthetic biology, bioremediation, and the development of novel biotechnological processes capable of functioning under extreme conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.