Recombinant Thioalkalivibrio sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please indicate your preference during order placement, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specification.
Synonyms
yidC; Tgr7_3318; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-557
Protein Length
full length protein
Species
Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Target Names
yidC
Target Protein Sequence
MDNLRPVLYLSMLLVLFLIWQAWNRDYGPQPVAAPGAQEQVMDRDGVPAPPQDVPDAPVS EAVDAPTEVAPAEPDRRRIRVVTDVLDIEIDTRGGDLVRADLPTYPVSLRTPDQPIRLLD ERFRQYVAQSGLIHDRVPGVSGEGRAPSHHAIFQAERDEFRLADGQDELRVPLTWTSEDG VQVTKTYTFRRGDFLINVDHAVRNNSDQPWVGRQYRQIRHGSTPSRESWFLYTFTGVAYH DGRYEKLSLEDMAGKPLDKDVQGGWISIIQHYFLTAWVPFEHEINQFYTRVLGTPARPEH IIGMRSEAQTAAPGEETVFTSRFWVGPKEQAALKAIQPGLELTVDYGMLSFLAKPLFWVL DWIHNVVGNWGWAIIILTILIKLVFYKLSETSYRSMAKMRAVQPKMMQLKDRYGDDKQRM NQALMELYKKEKINPLGGCLPILVQIPVFIALYWVLLESVEMRQAPWILWIQDLSVRDPY FILPILMGVTMIAQYKLNPAPMDPIQQKLMMALPFVFTVFFAFFPAGLVLYWFVNNLLSI AQQWYITRNIEKAGKKG
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins into the membrane. It plays a role in integrating membrane proteins that insert both dependently and independently of the Sec translocase complex, including at least some lipoproteins. It also aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What structural features characterize the Thioalkalivibrio sp. YidC?

The YidC protein from Thioalkalivibrio sp. features a conserved structural organization common to the YidC family. The core structure includes five transmembrane helices that form a helical bundle arranged in a pentagonal configuration when viewed from the cytoplasm . According to structural modeling studies, the transmembrane domains are arranged in the order 4-5-3-2-6 (clockwise) from a cytoplasmic view .

A distinctive feature of YidC is its hydrophilic groove, which is open to the cytosol and penetrates partially into the membrane . This groove creates a distortion in the membrane bilayer, potentially thinning it to facilitate protein insertion . Outside the transmembrane region, YidC contains a cytoplasmic helical hairpin between TM2 and TM3, referred to as the "helical paddle domain" (HPD), which likely plays a role in substrate recognition and handling .

The protein contains several functionally critical residues, notably arginine 72 (R72), which faces the hydrophobic lipid core and forms important salt-bridge interactions with incoming substrate proteins during the insertion process .

How does the extreme environment of Thioalkalivibrio sp. influence its YidC structure?

Thioalkalivibrio sp. thrives in soda lakes, which represent dual extreme environments with pH ranging from 9.5 to 11 and salt concentrations up to saturation . These extreme conditions likely necessitate specific adaptations in the YidC protein to maintain functionality:

Environmental FactorProbable Adaptation in Thioalkalivibrio YidC
High pH (9.5-11)Modified charge distribution on protein surface
Enhanced stability of salt bridge networks
Altered pKa values of key functional residues
High Salt ConcentrationIncreased proportion of acidic residues on surface
Reduced hydrophobic surface exposure
Modified hydration layer dynamics
Combined StressorsUnique folding stability mechanisms
Specialized substrate recognition adaptations

While the core function and structural organization of YidC remain conserved, these adaptations enable the protein to perform essential membrane protein insertion functions under conditions that would denature most proteins . The amino acid sequence of Thioalkalivibrio sp. YidC, particularly in the transmembrane regions, likely reflects these environmental adaptations while preserving the critical functional residues like R72 that are essential for its insertase activity .

What expression and purification strategies are most effective for recombinant Thioalkalivibrio sp. YidC?

For successful expression and purification of recombinant Thioalkalivibrio sp. YidC, researchers should consider the following optimized protocol:

Expression System Selection:

  • E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

  • pET-based vectors with T7 promoter and appropriate fusion tags (His10-tag recommended)

  • Codon optimization of the Thioalkalivibrio sp. YidC sequence for E. coli expression

Expression Conditions:

  • Induction at OD600 0.6-0.8 with reduced IPTG concentration (0.1-0.3 mM)

  • Lower post-induction temperature (16-20°C) for 16-18 hours

  • Supplementation with 10% glycerol to stabilize membrane proteins

Purification Protocol:

  • Cell lysis by sonication or French press in buffer containing protease inhibitors

  • Membrane isolation through differential centrifugation (low speed followed by ultracentrifugation)

  • Membrane solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration

  • Affinity purification using Ni-NTA or TALON resin with gradual imidazole elution

  • Size exclusion chromatography using Superdex 200 in buffer containing 0.05% DDM

For functional studies, reconstitution into proteoliposomes or nanodiscs is recommended to maintain the native-like lipid environment essential for YidC activity . This methodological approach has been successfully applied to other YidC homologs and can be adapted specifically for the Thioalkalivibrio sp. variant.

What techniques provide the most valuable structural insights for YidC research?

A multi-faceted approach combining computational and experimental techniques yields the most comprehensive structural insights for YidC research:

Computational Methods:

  • Evolutionary coupling analysis (ECA) has proven highly effective in predicting contacts between YidC residues, revealing helix-helix interactions that define the core structure

  • Molecular dynamics simulations provide critical insights into conformational dynamics, particularly when studying YidC-substrate interactions and membrane distortions

  • Homology modeling based on available YidC structures, refined through experimental constraints

Experimental Structural Techniques:

  • Cryo-electron microscopy (cryo-EM) is particularly valuable for capturing YidC-substrate complexes and ribosome-bound states

  • X-ray crystallography, though challenging for full-length YidC, can provide high-resolution information for stable domains

  • Site-specific crosslinking to validate predicted contacts between transmembrane helices

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions and substrate interactions

The combination of evolutionary coupling analysis with molecular dynamics simulations has been particularly successful, as demonstrated in studies where this approach accurately predicted the pentagonal arrangement of transmembrane helices and identified functionally critical residues that were later confirmed experimentally .

How can the functionality of YidC mutants be reliably assessed?

Assessing YidC functionality requires a combination of in vivo and in vitro approaches that examine different aspects of its insertion mechanism:

In Vivo Complementation Assays:

  • Depletion strains where chromosomal YidC expression can be regulated (e.g., under arabinose control)

  • Transformation with plasmids expressing wild-type or mutant YidC variants

  • Growth assessment under various conditions to determine complementation efficiency

  • Critical control: Western blotting to confirm equal expression levels of all variants

Substrate Insertion Assays:

  • Monitoring insertion of model YidC substrates (e.g., Pf3 coat protein)

  • Protease protection assays to assess topology of inserted membrane proteins

  • Pulse-chase experiments to determine insertion kinetics

  • Fluorescent reporter fusions to quantify insertion efficiency

Structural Integrity Assessment:

  • Circular dichroism spectroscopy to confirm secondary structure maintenance

  • Limited proteolysis to examine domain folding

  • Thermal stability assays to compare stability of mutants versus wild-type

A comprehensive functionality assessment should include examining critical salt bridge interactions, particularly those involving R72, which forms stable interactions with substrate proteins (e.g., with D7 and D18 of Pf3 coat protein) during the insertion process . Previous studies have shown that mutations of structurally important residues such as T362 in TM2 and Y517 in TM6 completely inactivate YidC despite stable expression of the protein .

How does the mechanism of YidC-mediated protein insertion differ between SecYEG-dependent and independent pathways?

YidC functions through two distinct mechanistic pathways that exhibit important differences in structure, substrate handling, and energetics:

SecYEG-Dependent Mode:

  • YidC functions as a monomer that binds to the lateral gate of SecYEG, likely via its N-terminal transmembrane domain

  • It facilitates the lateral release of transmembrane helices from the SecY channel into the lipid bilayer

  • YidC enhances folding efficiency and promotes assembly of multi-subunit membrane protein complexes

  • This mode typically handles more complex substrates with large periplasmic domains or multiple transmembrane segments

Independent Insertion Mode:

  • YidC forms a hydrophilic groove that is open only to the cytosol and penetrates partially into the membrane

  • The groove creates a local membrane distortion that reduces the energy barrier for insertion

  • This mode primarily handles simpler substrates with limited periplasmic domains

  • Molecular dynamics simulations reveal that the central transmembrane groove of YidC significantly expands during substrate insertion

  • The transmembrane helices become more slanted during insertion, with angle differences exceeding 10 degrees

The cytoplasmic loops of YidC play critical roles in both pathways, making initial contacts with substrate proteins and guiding them into the insertion pathway . Additionally, in both modes, the conserved R72 residue forms crucial salt-bridge interactions with negatively charged residues of substrate proteins, stabilizing them during the insertion process .

What is the significance of the proposed evolutionary relationship between YidC and SecY?

The evolutionary relationship between YidC and SecY represents a fascinating insight into the development of cellular protein translocation machinery:

  • Structural evidence strongly suggests a unified evolutionary origin for SecY and YidC. The hairpin-interrupted three-TMH motif of YidC shows striking similarity to consensus proto-SecY elements, with each consensus helix from the YidC family matching to a consensus helix from proto-SecY with the same connectivity .

  • This relationship suggests that YidC may be viewed as a "half-channel" capable of forming a near-complete channel through antiparallel homodimerization, resembling the structure of a complete translocon .

  • The functional similarity between the proteins as mediators of membrane protein integration further supports their evolutionary connection. Both create hydrophilic environments within the membrane to facilitate protein insertion .

  • This relationship has implications for understanding primitive membrane protein insertion mechanisms and the evolution of increasing complexity in translocation systems.

  • The similar structural features observed in other proteins involved in membrane protein translocation, such as the hydrophilic grooves in Hrd1 and Der1 components of the retrotranslocation machinery for ER-associated degradation, suggest evolutionary conservation of these functional elements across diverse systems .

This evolutionary relationship provides a conceptual framework for understanding the broader family of membrane protein insertases and their mechanistic similarities despite sequence divergence.

What role does the R72 residue play in YidC function and how can its importance be experimentally validated?

The highly conserved arginine 72 (R72) residue plays a crucial role in YidC function:

Functional Significance of R72:

  • R72 is positioned in the core cavity of the YidC transmembrane region and forms critical salt-bridge interactions with incoming protein chains

  • During insertion, R72 forms stable salt-bridges with negatively charged residues of substrate proteins - for example, with D7 and D18 of the Pf3 coat protein during different stages of the insertion process

  • These salt-bridge interactions stabilize the substrate protein within the transmembrane helical groove of YidC

  • As the substrate protein moves toward the periplasmic side of the membrane, interactions with R72 appear to shift sequentially (e.g., from D7 to D18 in the case of Pf3), suggesting a "handoff" mechanism that facilitates directional movement

Experimental Validation Approaches:

  • Site-directed mutagenesis of R72 to neutral (alanine) or oppositely charged (glutamate) residues, followed by functional complementation assays

  • In vitro reconstitution assays comparing wild-type and R72 mutant YidC for substrate insertion efficiency

  • Molecular dynamics simulations comparing wild-type and R72 mutant interactions with substrate proteins

  • Crosslinking experiments with photoactivatable amino acids incorporated at the R72 position to capture substrate interactions

  • Electrophysiology measurements to determine if R72 mutations affect the ion-conducting properties of YidC

Salt bridge analysis using molecular dynamics simulations has confirmed that R72 is available for interacting with incoming substrate proteins and forms stable interactions that change dynamically during the insertion process . The sequential shift in salt-bridge interactions as the substrate moves through YidC highlights the importance of R72 in guiding directional insertion.

How can molecular dynamics simulations be optimized for studying YidC-mediated membrane insertion?

Molecular dynamics (MD) simulations offer powerful insights into YidC function but require careful optimization for meaningful results:

System Setup Optimization:

  • Membrane composition selection should reflect the native environment of Thioalkalivibrio sp., considering its extremophilic nature

  • Proper embedding of YidC in the membrane with correct orientation based on hydrophobicity analysis

  • Inclusion of sufficient water molecules to fully hydrate the system, particularly the hydrophilic groove

  • Addition of counter-ions to neutralize the system and achieve physiological salt concentration

  • When studying substrate insertion, careful positioning of the substrate protein relative to YidC based on available experimental data

Simulation Parameters:

  • Selection of appropriate force fields validated for membrane proteins (e.g., CHARMM36 or AMBER lipid force fields)

  • Extended equilibration phase (typically >20-50 ns) to ensure membrane stability before production runs

  • Production runs of sufficient length - previous successful YidC simulations used 100-550 ns timeframes

  • For capturing the complete insertion process, non-equilibrium targeted MD approaches have proven effective with 100 ns simulation time and appropriate force constants (e.g., 44 kcal/mol/Ų)

Analysis Approaches:

  • Tracking salt bridge formation, particularly involving the critical R72 residue

  • Analyzing transmembrane helix angles to detect conformational changes during insertion

  • Monitoring membrane deformation around YidC

  • Principal component analysis (PCA) to identify dominant modes of motion

  • Contact analysis between YidC and substrate proteins, with particular focus on cytoplasmic loops and transmembrane regions

Previous studies successfully employed a combination of equilibrium and non-equilibrium MD simulations to investigate YidC-mediated insertion, revealing crucial conformational changes in the transmembrane helices and identifying key interactions involved in the insertion process .

What controls are essential when conducting mutagenesis studies of YidC?

Robust mutagenesis studies of YidC require a comprehensive set of controls to ensure reliable interpretation of results:

Essential Controls for YidC Mutagenesis:

Control TypeSpecific ControlsPurpose
Expression ControlsWestern blotting of all constructsVerify equal expression levels
Membrane fractionationConfirm proper membrane localization
GFP fusion variantsMonitor expression and localization in real-time
Functional ControlsWild-type YidCEstablish baseline function
Catalytically inactive mutant (e.g., R72A)Provide negative control
Known partially functional mutantsEstablish a range of activity
Experimental DesignMultiple biological replicates (n≥3)Ensure statistical significance
Various induction levelsDetermine threshold for complementation
Different growth conditionsAssess condition-dependent effects
Substrate-SpecificModel YidC substrates (e.g., Pf3)Verify specific substrate handling
SecYEG-dependent substratesTest pathway-specific effects

When conducting saturation mutagenesis or library screening, careful consideration of library design is essential. Previous successful YidC mutation studies have used approaches where mutations were introduced either throughout the entire YidC coding sequence or restricted to specific regions (e.g., residues 265-548) . Both approaches yielded valuable insights, but the restricted library allows for more focused investigation of particular functional domains.

Screening methods should be designed to identify both loss-of-function and gain-of-function mutations, and positive hits should be subjected to secondary validation to confirm the observed phenotypes .

How can evolutionary coupling analysis be optimized for studying Thioalkalivibrio sp. YidC?

Evolutionary coupling analysis (ECA) provides valuable structural insights for YidC research when properly optimized:

Sequence Alignment Optimization:

  • Begin with a seed alignment from protein family databases (e.g., PFAM family PF02096 for YidC)

  • Use sensitive homology detection software like HHblits against clustered sequence databases

  • Perform multiple iterations (≥5) to retrieve a diverse set of homologous sequences

  • Post-process the alignment to generate a non-redundant set at appropriate sequence identity threshold (90% recommended)

  • For Thioalkalivibrio sp. YidC, exclude the non-conserved first transmembrane helix (TM1) and periplasmic P1 domain from the analysis, as these regions show high variability

Coupling Analysis Implementation:

  • Compute direct evolutionary couplings between pairs of residues using established methods (e.g., Kamisetty et al., 2013)

  • Generate a matrix of coupling strengths and analyze for diagonal and anti-diagonal patterns indicative of parallel or anti-parallel helix-helix pairs

  • Compute probabilities for each possible helix-helix contact by aggregating evidence from stronger coupling coefficients

  • Calibrate the resulting raw scores on an independent dataset of helix-helix interactions to obtain accurate interaction probabilities

  • Focus on high-probability contacts (e.g., >57% probability) and distinguish them from low-probability background (typically <15%)

Model Building and Validation:

  • Position the transmembrane helices relative to each other using the predicted helix-helix contacts as constraints

  • Rotate the helices according to predicted lipid or protein exposure

  • Use modeling software (e.g., MODELLER) to create full-length models based on the TM core, secondary structure prediction, and the highest coupling coefficients

  • Validate the model through molecular dynamics simulations and experimental approaches like mutational analysis

This approach has been successfully applied to YidC homologs, resulting in accurate structural models that correctly predicted critical functional residues later validated through complementation assays .

How do substrate specificity determinants of Thioalkalivibrio sp. YidC compare to those of other bacterial species?

The substrate specificity determinants of YidC proteins across bacterial species reveal both conserved mechanisms and species-specific adaptations:

Conserved Substrate Specificity Determinants:

  • The hydrophilic groove formed by the transmembrane helices serves as the primary substrate interaction region in all YidC homologs

  • The positively charged R72 residue (or its equivalent) forms critical salt bridges with negatively charged residues in substrate proteins across species

  • Cytoplasmic loops, particularly those connecting transmembrane domains, play important roles in initial substrate recognition

  • The hydrophobic/hydrophilic boundary regions of transmembrane helices guide substrate positioning

Thioalkalivibrio-Specific Adaptations:

  • The extremophilic nature of Thioalkalivibrio likely necessitates adaptations in substrate handling under high pH and salt conditions

  • Modified surface charge distribution may affect interactions with substrate proteins

  • Altered hydrophobicity profiles in transmembrane helices might influence substrate selection

  • Specialized mechanisms for maintaining salt bridge stability under extreme conditions

Experimental Approaches to Compare Specificity:

  • Heterologous complementation studies to determine functional exchangeability between YidC from different species

  • In vitro reconstitution with model substrates to compare insertion efficiency

  • Chimeric YidC constructs combining domains from different species to map specificity determinants

  • Comparative molecular dynamics simulations of YidC-substrate interactions across species

Understanding these specificity determinants is particularly relevant for Thioalkalivibrio sp. YidC given the extensive genomic diversity within this genus, with over 100 strains isolated from various soda lakes worldwide . The adaptation of YidC to extreme environments may provide insights into substrate handling mechanisms under challenging conditions.

How does the water distribution within the YidC hydrophilic groove influence the insertion mechanism?

Water distribution within the YidC hydrophilic groove plays a crucial role in the insertion mechanism:

Water Distribution Characteristics:

  • Molecular dynamics simulations reveal that the hydrophilic groove of YidC contains a significant number of water molecules that form a partially hydrated environment

  • This creates a "water slide" force that helps guide substrate proteins toward the periplasmic side of the membrane

  • The hydration level varies along the groove, creating a gradient that facilitates directional movement

Functional Implications:

  • Water molecules mediate hydrogen bonding between charged/polar residues of YidC and substrate proteins

  • The hydrated environment reduces the energetic cost of inserting hydrophilic segments of substrate proteins through the membrane

  • The "water slide" effect combines with salt bridge interactions (particularly involving R72) to create a coordinated insertion mechanism

  • When the substrate protein is fully inside YidC's hydrophilic groove, hydration pushes the substrate into the lipid bilayer

Research Approaches:

  • Molecular dynamics simulations with explicit water molecules to track water distribution and dynamics

  • Mutations of residues that coordinate water molecules to assess their impact on insertion efficiency

  • Comparative analysis of water distribution patterns across YidC homologs from different environments

  • Correlation of hydration patterns with membrane distortion effects

The combination of the water slide force, salt bridge interactions, and membrane interactions collectively guides the substrate protein through the YidC hydrophilic groove and ultimately into the membrane bilayer . This hydration-assisted mechanism appears to be a fundamental aspect of YidC function across species.

What are the implications of YidC's ion-conducting properties for its function?

Recent research has revealed that YidC exhibits ion-conducting properties with significant functional implications:

Ion Conductance Characteristics:

  • Purified and reconstituted YidC forms an ion-conducting pore under certain conditions

  • This conductance may be regulated by substrate binding and insertion

  • The ion-conducting pathway likely involves the hydrophilic groove and charged residues within it

Functional Implications:

  • Ion conductance might serve as a mechanism to sense membrane potential during insertion

  • The electrostatic environment created by ion movement could influence substrate orientation

  • Changes in ion conductance during insertion may provide energy for conformational changes

  • The ion-conducting properties might explain how YidC maintains the membrane barrier to other molecules while allowing protein insertion

Research Questions:

  • How does substrate binding affect ion conductance?

  • Do mutations that affect insertion efficiency also alter ion conductance?

  • Is the ion conductance property conserved in extremophilic YidC variants like that from Thioalkalivibrio sp.?

  • How do extreme conditions (high pH, high salt) affect the ion-conducting properties?

Experimental Approaches:

  • Electrophysiology measurements of purified and reconstituted YidC

  • Correlation of ion conductance with substrate insertion efficiency

  • Site-directed mutagenesis of residues lining the hydrophilic groove to assess their impact on ion conductance

  • Comparative studies of YidC from different species under varying environmental conditions

Understanding the relationship between ion conductance and insertion function could provide new insights into the fundamental mechanism of YidC and potentially reveal new approaches for modulating its activity in research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.