Recombinant Thioalkalivibrio sp. Undecaprenyl-diphosphatase (uppP)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Tgr7_0330; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Target Names
uppP
Target Protein Sequence
MDLFQTLVLALVQGLTEFLPISSAAHLILVPELTDWDDQGLAFDVATHVGSLAAVVIYFR
HELRRMTAEWLGSLAGRGLTPDAKLAWAVGLGTIPAGLAGLLFHDIIATHLRSAQVIAMA
TIGFAVLLLFADVSGKRTRDEHSITWKDVLVIGVAQALALIPGTSRSGITITAALLMGFT
RQAAARYSFLLSIPIIALAGGFEILGLVKEPEENIQWGMIVLGALVAGVSAYLCIHYFLK
LLAKMTMLPFVIYRLVLGAFLLFLFW
Uniprot No.
Target Background
Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
KEGG: tgr:Tgr7_0330
STRING: 396588.Tgr7_0330
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
