Recombinant Thiobacillus denitrificans Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Cobalamin Synthase (CobS)

Cobalamin synthase (CobS) is a critical enzyme in the aerobic biosynthesis pathway of vitamin B₁₂ (cobalamin), responsible for adenosylcobalamin production. In Thiobacillus denitrificans, CobS functions as part of a heterotrimeric cobalt chelatase complex (CobNST) that facilitates cobalt insertion into the corrin ring during the late stages of cobalamin synthesis . This enzyme is distinct from homologs in anaerobic pathways, such as those in Salmonella typhimurium, where cobalt insertion occurs earlier . Recombinant CobS refers to the enzyme produced through genetic engineering, enabling detailed functional and structural studies.

Genomic Context in Thiobacillus denitrificans

The genome of T. denitrificans (2.9 Mbp) encodes a diverse metabolic repertoire, including genes for cobalamin biosynthesis . Key features include:

  • Operon organization: The cob genes in T. denitrificans are clustered, similar to Pseudomonas denitrificans, but lack full homology with anaerobic pathways .

  • Cobalt chelatase complex: The cobS gene is part of the cobNST cluster, which is essential for aerobic cobalt insertion. This distinguishes it from anaerobic systems that use cbiK/X for cobalt chelation .

Enzymatic Function and Pathway Role

CobS in T. denitrificans operates within the following pathway stages:

  1. Cobalt insertion: CobS works with CobN and CobT to insert cobalt into hydrogenobyrinic acid, forming cobyrinic acid .

  2. Adenosylation: Post-cobalt insertion, CobS participates in adenosyl ligand attachment to the metal center, a step critical for coenzyme activity .

  3. Amidation: CobS collaborates with CobQ to convert carboxyl groups on the corrin ring into amides, stabilizing the cobalamin structure .

Table 1: Key Differences Between Aerobic and Anaerobic Cobalamin Pathways

FeatureAerobic Pathway (e.g., T. denitrificans)Anaerobic Pathway (e.g., S. typhimurium)
Cobalt insertion timingLate-stage (post-corrin ring synthesis)Early-stage
Key enzymesCobNST complex (CobN, CobS, CobT)CbiK/X
Oxygen requirementYesNo
Methylation stepsSix SAM-dependent methylationsFive SAM-dependent methylations

Recombinant Expression and Applications

Recombinant CobS has been expressed in heterologous systems like Rhodobacter sphaeroides for functional studies . Key findings include:

  • High-yield production: Engineered promoters in R. sphaeroides achieve elevated CobS expression levels .

  • Biotechnological relevance: Used to optimize industrial cobalamin production, leveraging T. denitrificans’s efficient cobalt-handling machinery .

Research Findings and Comparative Analysis

  • Substrate specificity: Unlike anaerobic homologs, CobS in T. denitrificans shows no "fallover" during catalysis, maintaining linear reaction rates even under high substrate loads .

  • Inhibition studies: Preincubation with ribulose 1,5-bisphosphate (RuBP) significantly inhibits CobS activity, suggesting regulatory interplay with central carbon metabolism .

  • Genetic knockouts: Mutants lacking cobS fail to synthesize adenosylcobalamin, confirming its indispensability in the aerobic pathway .

Future Perspectives

Research priorities include:

  • Structural resolution: Crystallizing T. denitrificans CobS to elucidate mechanistic details of cobalt chelation.

  • Metabolic engineering: Leveraging recombinant CobS to enhance vitamin B₁₂ yields in industrial strains like P. denitrificans .

  • Environmental applications: Harnessing T. denitrificans’s cobalamin pathway for bioremediation, given its dual role in nitrogen and sulfur cycling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, keep working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Tbd_2710; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Thiobacillus denitrificans (strain ATCC 25259)
Target Names
cobS
Target Protein Sequence
MRGLILALGFLTRLPLPVLRDFQCAELVRAVVWFPAAGLVVGAAVALAAALGTVLDPWLG ALAGVVMWAWITGGLHLDGLADTADALGAAHRDPARFLTVLADPHVGSFGVIVLVLQLAA KLVLLHWLLTLDLPWPALVLIPAWTRWAAAGWTLLLPPLKPGLGERFAWQGNRAGWGAGG LALAAVSAITPIAFVALIPAVLWGVWMWLKLGGQTGDILGAGIEWSESAALLLAGVSLAL ARGIIAG
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Thiobacillus denitrificans* catalyzes the final two steps in the biosynthesis of cobalamin (vitamin B12). It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cobalamin synthase (cobS) in Thiobacillus denitrificans?

Cobalamin synthase (cobS) in T. denitrificans is a key enzyme in the biosynthetic pathway of vitamin B12. Similar to other bacterial cobS proteins, it likely catalyzes one of the final steps in cobalamin assembly. Based on homology with known cobalamin synthesis pathways, cobS is involved in the attachment of the lower ligand to the corrin ring structure. This enzyme belongs to a larger gene cluster responsible for complete cobalamin synthesis, which researchers have identified as requiring at least 14 different genes across multiple genomic loci .

How does recombinant cobS expression differ from native expression in T. denitrificans?

Recombinant expression of T. denitrificans cobS often faces challenges similar to those encountered with other B12-related proteins. While native expression occurs in the context of a complete pathway with appropriate cellular conditions and potential protein-protein interactions, recombinant systems must account for these factors. As observed with other cobalamin-related proteins like BtuM, the absence of the native membrane environment can preclude proper function of these proteins in vitro . Successful recombinant expression typically requires optimization of expression systems, buffer conditions, and potentially co-expression with other pathway components.

What is the relationship between cobS and other enzymes in the cobalamin biosynthetic pathway?

The cobS enzyme operates as part of a coordinated pathway involving multiple enzymes. In Pseudomonas denitrificans (a related organism), researchers have identified at least 14 different genes involved in cobalamin synthesis through complementation and restriction mapping analysis . This suggests that cobS functions within a complex network of enzymes, potentially forming part of an enzyme complex or participating in substrate channeling. Each enzyme in this pathway catalyzes a specific chemical modification of the growing cobalamin molecule, with cobS playing a critical role in the late stages of biosynthesis.

What expression systems are most effective for producing functional recombinant T. denitrificans cobS?

Based on experiences with similar cobalamin-related proteins, the most effective expression systems for T. denitrificans cobS likely include:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3) with pET vectorsHigh yield potential, well-established protocolsMay require optimization of induction conditions and temperature
E. coli Rosetta strainsAddresses codon bias issues common in non-E. coli genesSlightly lower yields but better full-length protein production
Cold-adapted expression systemsImproved protein folding at lower temperaturesLonger expression times required (16-24 hours)

Success with similar proteins has been achieved using low-temperature induction (16-18°C) and the addition of specific cofactors during expression to promote proper folding .

What purification strategies yield the highest enzymatic activity for recombinant cobS?

For optimal purification of catalytically active T. denitrificans cobS, consider the following multi-step approach:

  • Initial capture using affinity chromatography (typically IMAC for His-tagged constructs)

  • Intermediate purification using ion exchange chromatography

  • Final polishing step using size exclusion chromatography

Critical considerations for maintaining enzymatic activity include:

  • Inclusion of reducing agents (1-5 mM DTT) throughout purification to protect catalytic cysteine residues

  • Addition of glycerol (10-20%) to stabilize the protein structure

  • Maintaining a controlled temperature (4°C) throughout the purification process

  • Including appropriate metal cofactors (typically magnesium) in purification buffers

Similar approaches have been successful for related cobalamin-processing enzymes like BtuM .

How can the catalytic activity of T. denitrificans cobS be reliably assayed?

Developing a reliable assay for T. denitrificans cobS activity requires careful consideration of substrate availability and product detection. Based on protocols developed for similar enzymes:

  • Direct activity measurement:

    • Substrate: Partially synthesized cobalamin precursor

    • Detection: HPLC analysis of reaction products

    • Monitoring: Absorbance at specific wavelengths characteristic of cobalamin intermediates

  • Coupled enzyme assay:

    • Primary reaction: cobS-catalyzed reaction

    • Coupling enzyme: Enzyme that utilizes the cobS product

    • Detection: Spectrophotometric monitoring of coupled reaction

  • Isotope incorporation:

    • Labeled substrate: Radioactively labeled precursors

    • Detection: Scintillation counting or autoradiography

    • Advantage: High sensitivity for low-activity preparations

The optimal buffer conditions typically include HEPES or phosphate buffer (pH 7.5-8.0), reducing agents, and magnesium cofactors similar to those used for BtuM activity assays .

How do mutations in key catalytic residues affect cobS activity and cobalamin synthesis?

Structure-function studies of cobalamin-processing enzymes reveal several critical residues that may have parallels in T. denitrificans cobS:

Residue TypeFunctional RoleEffect of MutationExperimental Evidence
Cysteine residuesOften involved in substrate binding or catalysisComplete loss of activityDemonstrated in BtuM where C80A and C80S mutations abolished decyanation activity
Histidine residuesMetal coordination or catalytic functionVariable effects depending on positionH28A mutation in related proteins shows altered activity but not complete inactivation
Conserved aspartateOften critical for catalytic mechanismTypically severe loss of activityD67A mutation in similar proteins prevented proper folding

Studies with BtuM have shown that while some conserved residues (H28, Y85, R153) can be mutated with retention of partial activity, cysteine residues critical for catalysis cannot be substituted without loss of function .

What is the structural basis for cobS substrate specificity?

The structural basis for cobS substrate specificity likely involves several key elements:

  • Binding pocket architecture:

    • Presence of a nucleotide-binding domain for interaction with the nucleotide portion of the substrate

    • Hydrophobic pocket for corrin ring accommodation

    • Metal-coordinating residues for interaction with cobalt

  • Substrate recognition features:

    • Specific residues for hydrogen bonding with substrate functional groups

    • Conformational changes upon substrate binding

    • Potential "induced fit" mechanism similar to other cobalamin-processing enzymes

  • Comparative structural insights:

    • Related enzymes like BtuM show specific binding modes with cysteine ligation and base-off conformation of cobalamin

    • Binding may involve reductive mechanisms, with cysteine residues playing a critical role in electron transfer

Understanding these structural elements could facilitate engineering cobS for modified substrate specificity or enhanced catalytic efficiency.

How does T. denitrificans cobS function differ under aerobic versus anaerobic conditions?

T. denitrificans is a facultative anaerobe capable of denitrification, suggesting its cobalamin biosynthesis pathway may be differentially regulated under varying oxygen conditions:

  • Enzymatic considerations:

    • Oxygen sensitivity of cobalt coordination chemistry may necessitate different cofactor requirements under aerobic vs. anaerobic conditions

    • Redox state of critical cysteine residues may be affected by oxygen levels, similar to observations in BtuM where cysteine residues are essential for function

    • Potential conformational changes in enzyme structure under different redox environments

  • Regulatory aspects:

    • Expression levels of cobS may be differentially regulated based on oxygen availability

    • Potential post-translational modifications under different growth conditions

    • Integration with broader metabolic networks that respond to oxygen status

  • Experimental approaches:

    • Comparative activity assays under defined oxygen concentrations

    • Analysis of cobS expression and modification under aerobic vs. anaerobic growth

    • Structural studies of enzyme in different redox states

This understanding is particularly relevant for optimizing recombinant expression and characterization conditions.

How does cobS interact with other enzymes in the cobalamin biosynthetic pathway?

The interaction of cobS with other pathway enzymes likely involves both direct protein-protein interactions and substrate channeling mechanisms:

  • Protein complex formation:

    • Potential formation of multi-enzyme complexes for efficient substrate transfer

    • Regulatory interactions that coordinate activity levels of sequential enzymes

    • Structural domains specifically evolved for protein-protein interactions

  • Metabolic channeling:

    • Direct transfer of intermediates between enzymes without release into bulk solvent

    • Protection of reactive intermediates from side reactions

    • Enhanced pathway flux compared to freely diffusing intermediates

  • Experimental evidence from related systems:

    • In P. denitrificans, genomic clustering of cobalamin synthesis genes suggests functional coordination

    • Complementation analysis has identified at least four genomic loci involved in coordinated cobalamin synthesis

Understanding these interactions could provide insights for synthetic biology approaches to reconstruct or enhance the cobalamin synthesis pathway.

What are the rate-limiting steps in the T. denitrificans cobalamin synthesis pathway involving cobS?

Identifying rate-limiting steps in the cobalamin synthesis pathway requires integrated analysis of enzyme kinetics and pathway flux:

  • Enzyme kinetic parameters:

    • Comparison of kcat/Km values for cobS versus other pathway enzymes

    • Assessment of product inhibition and substrate availability effects

    • Measurement of enzyme stability and turnover number under physiological conditions

  • Pathway flux control:

    • Metabolic control analysis to determine flux control coefficients

    • Assessment of intermediate pool sizes at steady state

    • Overexpression studies to identify bottlenecks

  • Physiological context:

    • Effects of environmental conditions on relative enzyme activities

    • Regulatory mechanisms that modulate enzyme expression or activity

    • Integration with broader cellular metabolism

Experimental evidence from other bacterial systems suggests that late-stage enzymes like cobS can often be rate-limiting due to the complexity of their substrates and reactions .

How has evolution shaped the cobS enzyme across different bacterial species?

Evolutionary analysis of cobS across bacterial lineages reveals important insights about its functional conservation and adaptation:

  • Sequence conservation patterns:

    • Highly conserved catalytic residues across diverse bacteria

    • Variable regions that may reflect adaptation to specific ecological niches

    • Conservation patterns correlated with substrate specificity or catalytic efficiency

  • Phylogenetic distribution:

    • Present across diverse bacterial phyla but with notable patterns of loss

    • Potential horizontal gene transfer events in certain lineages

    • Co-evolution with other cobalamin synthesis and utilization genes

  • Structural evolution:

    • Conservation of core structural elements despite sequence divergence

    • Lineage-specific structural adaptations

    • Correlation of structural features with enzymatic properties

This evolutionary perspective provides context for understanding T. denitrificans cobS function and can guide protein engineering efforts.

How can recombinant T. denitrificans cobS be utilized for in vitro cobalamin synthesis?

The application of recombinant cobS for in vitro cobalamin synthesis presents several opportunities and challenges:

  • Enzymatic synthesis approaches:

    • Cell-free synthesis systems incorporating purified cobS and other pathway enzymes

    • Immobilized enzyme reactors for continuous production

    • Coupled multi-enzyme systems that regenerate cofactors

  • Technical considerations:

    • Stability of enzymes under reaction conditions

    • Cofactor regeneration (ATP, reducing equivalents)

    • Solubility and handling of hydrophobic intermediates

  • Potential advantages:

    • Precise control over reaction conditions

    • Production of specifically modified cobalamin derivatives

    • Elimination of extraction and purification steps needed for microbial production

This approach could facilitate production of isotopically labeled or chemically modified cobalamin molecules for research applications.

What computational approaches are most effective for studying cobS structure and function?

Modern computational methods provide powerful tools for studying cobS structure and function:

  • Structural prediction and analysis:

    • Homology modeling based on related enzymes with known structures

    • Molecular dynamics simulations to assess conformational dynamics

    • Docking studies to predict substrate binding modes and enzyme-enzyme interactions

  • Sequence-based approaches:

    • Coevolutionary analysis to identify functionally coupled residues

    • Consensus sequence analysis to identify critical conserved positions

    • Ancestral sequence reconstruction to understand evolutionary trajectory

  • Systems-level modeling:

    • Flux balance analysis of the complete cobalamin synthesis pathway

    • Integration with genome-scale metabolic models

    • Kinetic modeling to predict pathway behavior under varying conditions

These computational approaches can generate testable hypotheses and guide experimental design for cobS characterization.

How might CRISPR-Cas9 genome editing facilitate the study of T. denitrificans cobS in vivo?

CRISPR-Cas9 technology offers powerful approaches for studying cobS function in its native context:

  • Genetic manipulation strategies:

    • Generation of clean knockouts to assess essentiality

    • Introduction of point mutations to test specific mechanistic hypotheses

    • Creation of reporter fusions to monitor expression patterns

  • Regulatory studies:

    • Targeted modification of promoter elements

    • Engineering of regulatory circuits to control expression

    • Generation of conditional mutants for essential genes

  • Pathway engineering:

    • Simultaneous modification of multiple genes in the cobalamin synthesis pathway

    • Introduction of heterologous genes to create hybrid pathways

    • Optimization of expression levels for enhanced production

This technology has been successfully applied to similar metabolic engineering challenges and could significantly accelerate understanding of cobS function in T. denitrificans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.