Recombinant Thiobacillus denitrificans Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Tbd_2382; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Thiobacillus denitrificans (strain ATCC 25259)
Target Names
plsY
Target Protein Sequence
MIHLLLVVAAYLLGSLSFAVIVSRAMGLPDPRSFGSGNPGATNVLRTGRKTAAILTLLGD ALKGWVAVVAARGLAAQFGLDDDIVLLCALAAFIGHLFPVFFGFQGGKGVATALGILVAL DPWLGLACLATWVAMALVFRISSLSALVTAVLAPVYAGLLLGWNDSATTVLVIALLLVYR HKANLLKLVTGQEARIGKRS
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Thiobacillus denitrificans and why is it significant for genetic research?

Thiobacillus denitrificans is an obligately chemolithoautotrophic, sulfur-compound-oxidizing, β-proteobacterium with a unique metabolic profile. Its significance stems from several distinctive characteristics:

  • It can couple denitrification to sulfur-compound oxidation

  • It catalyzes anaerobic, nitrate-dependent oxidation of Fe(II) and U(IV)

  • It can oxidize mineral electron donors

  • Its genome (2,909,809-bp) contains genes encoding c-type cytochromes totaling 1-2% of the genome

  • It possesses genes encoding two [NiFe]hydrogenases that play roles in metabolism

  • It contains a diverse complement of more than 50 genes associated with sulfur-compound oxidation

These characteristics make T. denitrificans an excellent model organism for studying unique metabolic pathways and for potential applications in biogeochemical cycles and groundwater restoration .

What genetic manipulation systems are available for T. denitrificans?

A comprehensive genetic system has been developed for T. denitrificans that enables:

  • Introduction of insertion mutations via homologous recombination

  • Complementation of mutations in trans

  • Transformation with foreign DNA by electroporation

  • Creation of insertion mutations by in vitro transposition

  • Amplification of mutated genes by PCR

The IncP plasmid pRR10 serves as an effective vector for complementation studies. This genetic system has been validated through experiments with the hynL gene, encoding a [NiFe]hydrogenase large subunit. Interruption of hynL resulted in a 75% decrease in specific hydrogenase activity relative to wild type, while complementation restored activity to 50% above wild type levels .

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its metabolic significance?

Glycerol-3-phosphate acyltransferase (GPAT), including the plsY acyltransferase, catalyzes the conversion of glycerol-3-phosphate and long-chain acyl-CoA to lysophosphatidic acid. This represents the first and rate-limiting step in the de novo pathway of glycerolipid synthesis .

While the search results don't specifically address plsY in T. denitrificans, GPATs in general:

  • Play pivotal roles in regulating triglyceride and phospholipid synthesis

  • Have been implicated in metabolic processes through gain-of-function and loss-of-function experiments

  • Are involved in development of conditions such as obesity, hepatic steatosis, and insulin resistance in mammalian systems

  • Have different isoforms with varying subcellular localizations, substrate preferences, and NEM sensitivity

What are the typical steps involved in expressing recombinant proteins in T. denitrificans?

Based on the established genetic system for T. denitrificans, the expression of recombinant proteins typically involves:

  • Gene identification and amplification via PCR

  • Cloning into appropriate expression vectors

  • Transformation into T. denitrificans via electroporation

  • Selection of transformants using appropriate antibiotics

  • Verification of recombinant protein expression

  • Characterization of protein activity

The antibiotic sensitivity profile of T. denitrificans has been characterized to enable effective selection strategies, and transformation procedures have been optimized for foreign DNA introduction by electroporation .

StepProcedureCritical Parameters
1. Gene identificationGenome analysis and primer designCodon usage, restriction sites
2. CloningInsertion into vector (e.g., pRR10)Compatible restriction enzymes, promoter selection
3. TransformationElectroporationCell competency, DNA concentration, pulse parameters
4. SelectionAntibiotic screeningAppropriate antibiotic concentration
5. Expression verificationProtein detection methodsAntibody availability, fusion tags
6. Activity assaysEnzyme-specific protocolsBuffer composition, substrate availability

What approaches can be used to study the structural features of recombinant plsY from T. denitrificans?

Structural characterization of recombinant plsY from T. denitrificans could follow similar approaches to those used for APS kinase from the same organism:

  • X-ray crystallography after protein purification to determine three-dimensional structure

  • Sequence and structural comparison with homologous enzymes from other organisms

  • Analysis of active site architecture and substrate-binding domains

  • Investigation of oligomeric assembly (APS kinase from T. denitrificans exhibits a hexameric assembly with D₃ symmetry)

  • Identification of key residues through site-directed mutagenesis

  • Computational modeling to predict structure-function relationships

Such structural insights would provide valuable information about the enzyme's catalytic mechanism and substrate specificity, similar to how structural analysis of the two-domain hexameric APS kinase from T. denitrificans revealed the structural basis for the absence of ATP sulfurylase activity .

How can researchers effectively design experiments to investigate plsY function when data contradicts initial hypotheses?

When experimental data contradicts initial hypotheses about plsY function, researchers should:

  • Thoroughly examine the data: Identify discrepancies and patterns that contradict the initial hypothesis. Compare findings with existing literature and pay close attention to potential outliers .

  • Evaluate initial assumptions: Reassess the foundational assumptions of the experimental design and consider alternative explanations for unexpected results .

  • Refine experimental conditions: Modify the following parameters to address potential sources of error:

    ParameterPotential Adjustments
    Growth conditionsTemperature, media composition, aeration
    Protein expressionInduction timing, inducer concentration
    Enzyme assayBuffer composition, substrate concentration, detection method
    ControlsAdditional positive/negative controls, wild-type comparisons
  • Consider alternative functions: As demonstrated with the APS kinase from T. denitrificans (which contains an inactive N-terminal ATP sulfurylase domain), some enzymes may have unexpected or evolved functions different from their homologs in other organisms .

  • Implement additional controls: Include well-characterized enzymes from other organisms as benchmarks for activity comparisons .

  • Approach with an open mind: Recognize that unexpected findings may lead to new discoveries about enzyme function or regulation .

What are effective strategies for optimizing recombinant plsY expression levels in T. denitrificans?

Based on established genetic systems for T. denitrificans, researchers can optimize recombinant plsY expression through:

  • Vector selection: The IncP plasmid pRR10 has been demonstrated as an effective complementation vector in T. denitrificans .

  • Promoter optimization: Select promoters compatible with T. denitrificans transcriptional machinery, potentially using native promoters from highly expressed genes.

  • Codon optimization: Adjust codon usage to match preferences in T. denitrificans, which as a chemolithoautotroph may have different codon bias than model heterotrophic organisms.

  • Expression conditions: Optimize growth and induction conditions specific to T. denitrificans' chemolithoautotrophic lifestyle.

  • Fusion tags: Incorporate purification and solubility-enhancing tags that have been validated in T. denitrificans or closely related species.

  • Chaperone co-expression: Consider co-expressing molecular chaperones to enhance proper folding and stability.

How does the substrate specificity of T. denitrificans plsY potentially differ from other bacterial acyltransferases?

While specific information about T. denitrificans plsY is not provided in the search results, potential differences in substrate specificity could be inferred from:

  • Unique metabolic requirements: As an obligate chemolithoautotroph, T. denitrificans may require specialized membrane lipid composition to support its unusual metabolism, potentially reflected in plsY substrate preferences.

  • Sequence differences: Comparative genomic analysis might reveal unique residues in the substrate binding pocket of T. denitrificans plsY compared to homologs from heterotrophic bacteria.

  • Environmental adaptations: T. denitrificans' ability to grow in various redox conditions (aerobic and anaerobic) might necessitate adaptations in membrane lipid metabolism enzymes, including plsY.

  • Evolutionary considerations: Like the APS kinase that evolved from a bifunctional enzyme to lose one activity, T. denitrificans plsY might have evolved specific substrate preferences different from other bacterial acyltransferases .

A systematic enzyme kinetic analysis using various acyl-CoA donors would be necessary to fully characterize these potential differences.

What are the optimal electroporation parameters for transforming T. denitrificans with recombinant plsY constructs?

Based on the established genetic system for T. denitrificans, optimized electroporation parameters would likely include:

ParameterRecommended ValueNotes
DNA concentration0.5-1 μgPurified plasmid DNA, free of salts
Cell densityOD₆₀₀ of 0.4-0.6Mid-log phase culture
Washing buffer10% glycerolMultiple washes to remove salts
Cuvette gap0.1 or 0.2 cmDepending on available equipment
Voltage1.5-2.5 kVOptimized for cell survival and transformation efficiency
Resistance200-400 ΩMay require adjustment based on equipment
Capacitance25-50 μFStandard for bacterial transformation
Recovery mediaT. denitrificans growth mediumWithout antibiotics
Recovery time4-12 hoursExtended due to slower growth rate of chemolithoautotrophs

The specific parameters would need to be optimized based on the particular strain and plasmid used, similar to how the electroporation procedure was established for introducing foreign DNA in previous T. denitrificans studies .

How can researchers effectively design activity assays for recombinant plsY from T. denitrificans?

Designing effective activity assays for recombinant plsY from T. denitrificans would involve:

  • Substrate preparation: Both glycerol-3-phosphate and appropriate acyl-CoA donors must be available in pure form.

  • Product detection methods:

    • Radiochemical assays using ¹⁴C-labeled substrates

    • Colorimetric detection of free CoA release

    • HPLC or mass spectrometry-based detection of lysophosphatidic acid formation

    • Coupled enzyme assays that link plsY activity to a detectable signal

  • Reaction conditions optimization:

    ParameterConsiderations
    pHTest range 6.0-8.5 to determine optimum
    TemperatureTypically 25-37°C, based on organism growth temperature
    Divalent cationsTest Mg²⁺, Mn²⁺, Ca²⁺ requirements
    Reducing agentsDTT or β-mercaptoethanol may be required
    DetergentsLow concentrations to maintain enzyme stability
    Ionic strengthNaCl or KCl concentration optimization
  • Controls and validations:

    • Heat-inactivated enzyme negative control

    • Known acyltransferase as positive control

    • Substrate and product standards for calibration

  • Kinetic parameter determination:

    • Establish linear range for reaction time and enzyme concentration

    • Determine K<sub>m</sub> and V<sub>max</sub> for both glycerol-3-phosphate and acyl-CoA substrates

    • Evaluate potential inhibitors

Similar approaches have been used successfully to characterize enzyme activities in T. denitrificans, as demonstrated with the characterization of hydrogenase activity in wild-type, mutant, and complemented strains .

What strategies can be employed to analyze the role of plsY in the lipid metabolism of T. denitrificans?

To analyze the role of plsY in T. denitrificans lipid metabolism, researchers can employ:

  • Genetic approaches:

    • Generate plsY insertion mutants using the established genetic system for T. denitrificans

    • Create conditional mutants if plsY is essential

    • Complement mutations with wild-type or site-directed mutant versions

    • Use the IncP plasmid pRR10 as a vector for complementation studies

  • Biochemical approaches:

    • Analyze membrane lipid composition in wild-type vs. mutant strains

    • Perform in vitro reconstitution of lipid synthesis pathways

    • Evaluate changes in membrane properties (fluidity, permeability)

  • Physiological studies:

    • Assess growth characteristics under various conditions

    • Measure changes in stress resistance

    • Evaluate impact on other metabolic pathways

  • Multi-omics integration:

    • Transcriptomic analysis to identify compensatory changes

    • Proteomic studies to evaluate protein expression changes

    • Metabolomic analysis to map altered metabolic fluxes

    • Lipidomic profiling to characterize membrane composition changes

These approaches would build upon the genetic system developed for T. denitrificans, which has already demonstrated success in studying other metabolic genes through insertion mutations and complementation .

How can researchers troubleshoot issues with protein solubility when expressing recombinant plsY from T. denitrificans?

When facing solubility issues with recombinant plsY expression, researchers can implement the following troubleshooting strategies:

  • Expression condition optimization:

    ParameterPotential Adjustments
    TemperatureLower to 16-25°C during induction
    Induction timeShorter induction periods
    Inducer concentrationReduce to limit expression rate
    Media compositionSupplement with osmolytes or chaperone inducers
    Growth phaseInduce at different cell densities
  • Construct design improvements:

    • Add solubility-enhancing fusion tags (MBP, SUMO, thioredoxin)

    • Remove predicted transmembrane or hydrophobic domains

    • Express functional domains separately

    • Optimize codon usage for T. denitrificans

  • Buffer optimization during purification:

    • Screen various pH conditions (typically pH 6.0-8.5)

    • Test different salt concentrations (100-500 mM NaCl)

    • Include appropriate detergents for membrane-associated proteins

    • Add stabilizing agents (glycerol, reducing agents)

    • Consider specific ligands or substrates that might stabilize the protein

  • Alternative expression systems:

    • Test expression in E. coli or other well-established hosts

    • Use cell-free expression systems

    • Consider native purification from T. denitrificans

  • Structural prediction:

    • Use bioinformatics to identify problematic regions

    • Compare with successful expression of homologous proteins

    • Investigate potential post-translational modifications

These approaches build on established protocols for protein expression and the genetic manipulation system available for T. denitrificans .

How might research on T. denitrificans plsY contribute to our understanding of lipid metabolism in chemolithoautotrophic bacteria?

Research on T. denitrificans plsY could significantly advance our understanding of lipid metabolism in chemolithoautotrophic bacteria by:

  • Revealing adaptations to chemolithoautotrophy: Comparing plsY from T. denitrificans with homologs from heterotrophic bacteria could highlight specific adaptations in lipid metabolism required for a chemolithoautotrophic lifestyle.

  • Elucidating metabolic integration: Understanding how lipid synthesis interfaces with the unusual energy metabolism of T. denitrificans, including its ability to couple denitrification to sulfur compound oxidation and Fe(II) oxidation .

  • Identifying novel regulatory mechanisms: The regulation of lipid synthesis in organisms that derive energy from inorganic compounds may involve unique signaling pathways compared to heterotrophs.

  • Clarifying evolutionary relationships: Similar to how the APS kinase from T. denitrificans contains an inactive ATP sulfurylase domain, analysis of plsY might reveal evolutionary trajectories of lipid metabolism enzymes in specialized bacteria .

  • Informing biotechnological applications: Insights into T. denitrificans lipid metabolism could inform bioremediation strategies or biogeochemical engineering approaches.

What experimental approaches can integrate structural, biochemical, and genetic data to comprehensively characterize recombinant plsY function?

A comprehensive characterization of recombinant plsY function would integrate multiple experimental approaches:

  • Structural analysis:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • Molecular dynamics simulations to understand substrate binding

    • Structural comparisons with homologs from other organisms

  • Biochemical characterization:

    • Kinetic analysis with various substrates

    • Identification of regulatory factors

    • Determination of oligomeric state and protein-protein interactions

  • Genetic approaches:

    • Creation of knockout/knockdown mutants using the established genetic system

    • Complementation with wild-type and mutant versions

    • Phenotypic analysis of mutants under various growth conditions

  • Systems biology integration:

    • Transcriptomic analysis to identify co-regulated genes

    • Metabolomic studies to map affected pathways

    • Lipidomic profiling to characterize membrane composition changes

This integrated approach would build upon successful strategies used for other T. denitrificans enzymes, such as the characterization of hydrogenase function through combined genetic and biochemical methods .

ApproachTechniquesInformation Gained
StructuralX-ray crystallography, Homology modelingActive site architecture, Substrate binding sites
BiochemicalEnzyme kinetics, Substrate specificityCatalytic parameters, Regulatory mechanisms
GeneticGene knockout, ComplementationIn vivo function, Essentiality
Systems BiologyTranscriptomics, LipidomicsPathway integration, Global effects

How can unexpected findings about plsY function lead to new research directions?

Unexpected findings about plsY function can catalyze new research directions in several ways:

  • Novel enzymatic activities: Similar to how the T. denitrificans APS kinase was found to contain an inactive ATP sulfurylase domain, plsY might exhibit unexpected secondary activities or substrate specificities that could reveal new aspects of lipid metabolism .

  • Unexpected metabolic connections: Contradictory data might reveal connections between lipid metabolism and other pathways unique to chemolithoautotrophs, such as interactions with energy generation from inorganic compounds.

  • Regulatory insights: Unexpected effects of plsY manipulation might uncover novel regulatory mechanisms controlling lipid homeostasis in these specialized bacteria.

  • Evolutionary implications: Unusual features of T. denitrificans plsY could provide insights into the evolution of lipid metabolism enzymes and their adaptation to different ecological niches.

  • Biotechnological applications: Unexpected properties might be leveraged for biotechnological applications, such as bioremediation or production of specialized lipids.

When confronting unexpected findings, researchers should:

  • Thoroughly validate the observations with additional controls

  • Consider alternative hypotheses that might explain the data

  • Evaluate the findings in the context of the unique metabolism of T. denitrificans

  • Design follow-up experiments that can distinguish between competing explanations

The history of scientific discovery demonstrates that unexpected findings often lead to the most significant breakthroughs, as they challenge existing paradigms and open new investigative paths.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.