Recombinant Thiobacillus denitrificans Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and General Role of MsbA

MsbA (membrane-bound lipid A exporter) is an ATP-binding cassette (ABC) transporter essential for lipid A (the anchor of lipopolysaccharide, LPS) transport across the inner membrane in Gram-negative bacteria . It functions as a lipid flippase, translocating lipid A from the cytoplasmic leaflet to the periplasmic leaflet, enabling LPS assembly and outer membrane biogenesis .

Conformational States

MsbA adopts inward-facing (cytoplasmic-accessible) and outward-facing (periplasmic-accessible) conformations during ATP-dependent transport :

StateKey FeaturesReferences
Inward-FacingNBDs separated (~20 Å), TMDs create a hydrophobic chamber for lipid A binding
Outward-FacingNBDs dimerized, TMDs reorganized to release lipid A into the periplasm

Substrate Interactions

  • Lipid A Binding: Hydrophobic interactions with acyl chains and electrostatic contacts with glucosamine headgroups .

  • Drug Interaction: Amphipathic compounds (e.g., daunorubicin) compete with lipid A for binding, altering MsbA conformation .

ATPase Activity

MsbA couples ATP hydrolysis to substrate translocation. In E. coli, purified MsbA exhibits:

ParameterValueConditionsReferences
ATPase Activity2–4 nmol/min/mg (basal) → 7.7 nmol/min/mg (maximal)Reconstituted in E. coli lipids, pH 8.0, 37°C
StimulatorsLipid A, phospholipids (e.g., PE, PS)Kdo2-lipid A (EC50 ~21 µM)

Lipid Flippase Activity

MsbA translocates lipid A and phospholipids in a trap-and-flip mechanism :

SubstrateTranslocation RateReferences
NBD-PE (acyl chain)7.7 nmol/mg protein/20 min
Lipid AInhibited by competitive substrates

Inhibitor Discovery

Small-molecule inhibitors (e.g., G332, G592) block MsbA’s ATPase activity and bacterial growth by stabilizing non-conductive conformations .

Gaps in Thiobacillus denitrificans Research

  • No msbA Orthologs: Identified in publicly available T. denitrificans genomic data .

  • Hypothesis: Lipid A transport may rely on alternative ABC transporters or divergent MsbA homologs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
msbA; Tbd_2507; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Thiobacillus denitrificans (strain ATCC 25259)
Target Names
msbA
Target Protein Sequence
MSAPTSRHLYGRLLGYVKPHWRMFALSIVGLILTAATEPMLPALFKPLLDEGFVAKDQDF IRWVPLLLLGLFVLRGVASFISTYSMAWVGSRLVMDLRAAMFDKLMALPTRYFDQNPSGQ LIAQLAFNVTQVTQSATSSLTTLVRDTVTVLGLLGYLVWLNWRLTLIVFALVPLTLWVVR VASKRLRGLSRKAQENIGDLTQVVDEAVGGHRVVKLYGGETYEQARFHRAANLARQFEMK RVAANAVYEPVIQFIAAIALAIIVFIAAGQASANTTTVGGFVAFFMAMLLLFAPLKRLTA VNDQLQRGLAASETIFALLDQDAERDTGTREPAHIEGRLAFRDVGLTYPGKQTPALARIS LDIAPGETVALVGASGSGKTTLANLVPRFYDPDAGRIELDGVDIRDVKLQSLRGHIALVS QDVVLFNDTLAHNIAYGSKREASPDEIRAACVAAHAWDFIQAMPDGLDTLIGENGMRLSG GQRQRIAIARAILKNAPILILDEATSALDSESERHVQAALETLMQNRTTLVIAHRLSTIE RANRIVVLEGGRIVETGAHADLLAKQGRYAQLHALQFSQ
Uniprot No.

Target Background

Function

This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of MsbA protein in Thiobacillus denitrificans?

The MsbA protein from Thiobacillus denitrificans is a Lipid A export ATP-binding/permease protein that functions as a membrane transporter. Structurally, it contains 579 amino acids and belongs to the ATP-binding cassette (ABC) transporter family. The protein plays a crucial role in the export of lipopolysaccharide components across the bacterial membrane, specifically functioning as an ATP-dependent flippase that translocates lipid A from the inner to the outer leaflet of the cytoplasmic membrane .

The amino acid sequence contains characteristic domains including:

  • Nucleotide-binding domains (NBDs) that bind and hydrolyze ATP

  • Transmembrane domains (TMDs) that form the translocation pathway

  • Coupling helices that communicate conformational changes between domains

What are the optimal storage conditions for recombinant MsbA protein?

For short-term storage (up to one week), recombinant MsbA protein can be maintained at 4°C in working aliquots. For long-term storage, the protein should be kept at -20°C, and for extended preservation, -80°C is recommended. The protein is typically stored in a Tris-based buffer containing 50% glycerol that has been optimized for stability .

It is important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity. Working aliquots should be prepared during initial thawing to minimize freeze-thaw cycles .

What expression systems are typically used for producing recombinant MsbA from Thiobacillus denitrificans?

While the search results don't specify the exact expression system used for this particular recombinant protein, membrane proteins like MsbA are commonly expressed in systems including:

  • E. coli-based expression systems: Often modified to enhance membrane protein expression, such as C41(DE3) or C43(DE3) strains

  • Yeast expression systems: Particularly Pichia pastoris for complex membrane proteins

  • Insect cell expression systems: Used when proper folding and post-translational modifications are critical

The choice of expression system should be based on research needs, including required protein yield, functional activity, and downstream applications.

How can researchers optimize experimental protocols for studying MsbA-mediated lipid transport in Thiobacillus denitrificans?

To effectively study MsbA-mediated lipid transport in T. denitrificans, researchers should consider a multi-faceted approach:

Reconstitution in Liposomes:

  • Purify recombinant MsbA using affinity chromatography with appropriate detergents (typically DDM or LMNG)

  • Prepare liposomes with lipid compositions mimicking T. denitrificans membrane

  • Reconstitute the protein into liposomes using detergent removal methods (e.g., Bio-Beads, dialysis)

  • Assess ATP-dependent transport using fluorescently labeled lipid A analogs

ATPase Activity Assays:

  • Measure baseline activity using the purified protein

  • Test lipid A stimulation of ATPase activity

  • Analyze the effects of temperature, pH, and potential inhibitors

Site-Directed Mutagenesis:
Create mutants of key residues (based on the sequence provided in the search results) to assess their roles in transport function .

What methodological approaches can be used to study the interaction between MsbA and biofilm formation in Thiobacillus denitrificans?

Based on research with T. denitrificans and biofilm formation, several methodologies can be employed:

Quartz Crystal Microbalance with Dissipation Monitoring (QCM-D):
This technique has been successfully used to study the adhesion of T. denitrificans and can be adapted to investigate the role of MsbA. The QCM-D approach allows for real-time monitoring of biofilm formation under various conditions .

Experimental Protocol:

  • Immobilize recombinant MsbA on sensor surfaces

  • Monitor bacterial adhesion at different temperatures (10°C and 20°C as benchmark points)

  • Assess the influence of factors like rhamnolipids on MsbA-mediated processes

  • Analyze both the frequency and dissipation data to evaluate not only mass deposition but also viscoelastic properties of the forming biofilm

Data Collection Parameters:

ParameterStandard ConditionVariable RangeMeasurement Frequency
Temperature20°C10-30°CContinuous
Flow Rate50 μL/min25-100 μL/minContinuous
Bacterial Concentration10⁷ CFU/mL10⁵-10⁸ CFU/mLInitial setup
MsbA Surface Density500 ng/cm²100-1000 ng/cm²Initial setup

How does temperature affect the structural stability and function of MsbA in denitrifying conditions?

Temperature significantly impacts both bacterial adhesion and protein function in T. denitrificans. Research indicates that:

  • Low Temperature Effects (10°C):

    • Significantly inhibits adhesion of T. denitrificans (p < 0.05)

    • Creates more rigid deposited layers, which can negatively affect microorganism adhesion

    • May alter MsbA conformation and reduce ATP hydrolysis rates

  • Optimal Temperature Range (20°C):

    • Provides more favorable conditions for bacterial adhesion

    • Potentially maintains optimal MsbA activity

    • Allows for more viscoelastic biofilm formation with proper additives

For studying temperature effects on MsbA specifically, differential scanning calorimetry (DSC) and circular dichroism (CD) spectroscopy at various temperatures would provide valuable structural stability data. ATP hydrolysis assays conducted across a temperature gradient would complement the structural data with functional insights.

What role might MsbA play in rhamnolipid-mediated adhesion of Thiobacillus denitrificans?

Research has demonstrated that rhamnolipids significantly influence the adhesion of T. denitrificans, particularly in biofilm formation. While the direct relationship between MsbA and rhamnolipids isn't explicitly established in the search results, potential mechanisms can be proposed:

  • Membrane Fluidity Modulation:

    • Rhamnolipids (120-200 mg/L) regulate biofilm from rigid to viscoelastic states

    • This altered membrane environment may affect MsbA conformational changes required for ATP hydrolysis and lipid transport

  • Surface Interaction Dynamics:

    • Rhamnolipids reduce hydration repulsion forces, enhancing macromolecular deposition

    • MsbA-exported lipid A components may interact with these deposited macromolecules, influencing bacterial adhesion patterns

  • Experimental Approach for Investigation:
    The effect of rhamnolipids on MsbA activity could be investigated by:

    • Comparing wild-type and MsbA-deficient T. denitrificans strains in adhesion assays

    • Measuring ATP hydrolysis by purified MsbA in the presence of varying rhamnolipid concentrations

    • Assessing lipid A export in membrane vesicles with and without rhamnolipid treatment

This research direction could provide insights into whether MsbA is a key player in the observed rhamnolipid-mediated enhancement of T. denitrificans adhesion.

What purification strategies are most effective for obtaining high-yield, functionally active recombinant MsbA?

Purifying membrane proteins like MsbA requires specialized approaches to maintain structural integrity and function. A recommended protocol includes:

Step-by-Step Purification Protocol:

  • Cell Lysis and Membrane Isolation:

    • Harvest expression host cells and disrupt using mechanical methods (French press or sonication)

    • Separate membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Wash membrane pellet to remove peripheral proteins

  • Solubilization:

    • Resuspend membrane fraction in buffer containing appropriate detergent

    • Common detergents: n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG)

    • Incubate with gentle agitation (4°C, 1-2 hours)

    • Remove insoluble material by ultracentrifugation

  • Affinity Chromatography:

    • Using the tag present on the recombinant protein (as noted, "tag type will be determined during production process")

    • Common options include His-tag, FLAG-tag, or Strep-tag purification

    • Include detergent in all buffers to maintain protein solubility

  • Size Exclusion Chromatography:

    • Further purify by size to separate monomeric from aggregated protein

    • Assess protein quality by SDS-PAGE and Western blotting

Yield and Purity Assessment:

Purification StepExpected YieldPurity Assessment MethodTypical Purity
Membrane Fraction25-30 mg/L cultureSDS-PAGE10-15%
Affinity Purification5-10 mg/L cultureSDS-PAGE/Western Blot70-80%
Size Exclusion2-5 mg/L cultureSDS-PAGE/Mass Spectrometry>95%

How can researchers effectively analyze the ATP hydrolysis activity of MsbA and its modulation by lipid substrates?

ATP hydrolysis is a critical function of MsbA as an ABC transporter. The following methods provide comprehensive analysis of this activity:

Colorimetric Phosphate Release Assay:

  • Prepare reaction buffer containing purified MsbA (1-5 μg)

  • Add ATP (typically 1-5 mM) to initiate reaction

  • At timed intervals, stop reaction with acid or EDTA

  • Measure released phosphate using malachite green or similar reagent

  • Calculate initial rates from the linear portion of time course

Coupled Enzyme Assay:

  • Link ATP hydrolysis to NADH oxidation via pyruvate kinase and lactate dehydrogenase

  • Monitor decrease in NADH absorption at 340 nm in real-time

  • Calculate hydrolysis rates directly from absorption changes

Lipid Modulation Analysis:
To assess how lipid substrates affect MsbA activity, incorporate:

  • Various lipid A preparations at different concentrations

  • Phospholipid mixtures mimicking bacterial membranes

  • Potential lipid inhibitors or activators

Expected Data Interpretation:

ConditionExpected EffectAnalysis Approach
No LipidBaseline activitySet as 100% reference
Native Lipid A2-5 fold stimulationDetermine EC₅₀ and V<sub>max</sub>
Membrane PhospholipidsVariable modulationCompare dose-response curves
RhamnolipidsUnknown (research target)Assess concentration-dependent effects

How might MsbA function correlate with biofilm formation capabilities of Thiobacillus denitrificans under denitrifying conditions?

Building on the understanding that Thiobacillus denitrificans forms biofilms that are affected by environmental factors such as rhamnolipids, temperature, and surface characteristics, the role of MsbA can be investigated through:

Genetic Approaches:

  • Develop conditional MsbA mutants or knockdown strains of T. denitrificans

  • Compare biofilm formation between wild-type and mutant strains using crystal violet assays

  • Analyze biofilm structure using confocal microscopy and COMSTAT analysis

Biochemical Correlation:

  • Quantify MsbA expression levels in planktonic versus biofilm cells using qRT-PCR and Western blotting

  • Measure lipid A export in these different growth modes

  • Correlate MsbA activity with biofilm developmental stages

Environmental Variables Impact:
The data indicates that temperature significantly affects T. denitrificans adhesion, with low temperature (10°C) inhibiting adhesion . This suggests experimental designs should include:

Environmental FactorControl ConditionVariable RangeExpected Impact on MsbA
Temperature20°C10-30°CAltered activity and conformational stability
Oxygen LevelAnaerobicMicroaerobic to aerobicChanged expression patterns
Carbon SourceStandard mediaVarious carbon sourcesPotential regulatory effects
Rhamnolipid Concentration0 mg/L20-200 mg/LModified membrane environment

What analytical techniques are most appropriate for studying the structural dynamics of MsbA during its transport cycle?

Understanding the conformational changes of MsbA during its transport cycle requires sophisticated biophysical techniques:

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Expose purified MsbA to D₂O buffer at different stages of the transport cycle

  • Quench the exchange reaction and digest the protein

  • Analyze peptides by mass spectrometry to identify regions with altered solvent accessibility

  • Map changes to the protein structure to identify dynamic regions

Single-Molecule FRET:

  • Introduce fluorescent probes at specific sites in MsbA using site-directed mutagenesis

  • Measure distance changes between probes during ATP binding, hydrolysis, and release

  • Correlate FRET efficiency changes with structural models

Cryo-Electron Microscopy:

  • Prepare MsbA samples in different nucleotide-bound states

  • Collect high-resolution images and process to generate 3D reconstructions

  • Compare structures to identify conformational changes

Molecular Dynamics Simulations:
Using the full amino acid sequence available , conduct simulations to:

  • Model MsbA in a lipid bilayer environment

  • Simulate conformational changes during ATP binding and hydrolysis

  • Calculate energetic barriers between different states

  • Generate testable hypotheses for experimental validation

What are the most common difficulties encountered when working with recombinant MsbA and how can they be addressed?

Researchers working with membrane proteins like MsbA often face specific challenges:

Protein Aggregation:

  • Cause: Improper detergent selection or concentration

  • Solution: Optimize detergent screening using analytical size exclusion chromatography. Test multiple detergent types and concentrations, focusing on mild non-ionic detergents such as DDM, LMNG, or GDN.

Low Expression Yields:

  • Cause: Toxicity to expression host, improper induction conditions

  • Solution: Use specialized expression strains, lower induction temperature (16-20°C), and extend expression time. Consider testing multiple tag positions and fusion partners.

Loss of Activity During Purification:

  • Cause: Detergent stripping of essential lipids, protein denaturation

  • Solution: Add lipids during purification, minimize purification time, maintain consistent low temperature (4°C), and include stabilizing agents such as glycerol .

Inconsistent Functional Assays:

  • Cause: Batch-to-batch variation in protein preparation

  • Solution: Develop robust quality control checkpoints, including ATPase activity baseline measurements and thermostability assays.

Recommended Quality Control Panel:

TestAcceptance CriteriaTroubleshooting Step if Failed
Size Exclusion Profile>85% monodisperseOptimize detergent or buffer conditions
ATPase Activity>75% of standard referenceCheck for inhibitory contaminants or denaturation
Thermal StabilityTm within 3°C of referenceAdjust buffer components or add stabilizers
SDS-PAGE>90% purityImplement additional purification steps

How can researchers differentiate between the effects of MsbA function and other factors in Thiobacillus denitrificans biofilm studies?

When studying complex biological systems like biofilms, isolating the specific contribution of a single protein requires careful experimental design:

Control Strategies:

  • Genetic Controls:

    • Create isogenic strains differing only in MsbA expression/function

    • Use complementation studies to verify phenotypes

    • Develop inducible expression systems to titrate MsbA levels

  • Pharmacological Approaches:

    • Use specific inhibitors of ABC transporters (with appropriate controls)

    • Compare with inhibitors targeting other cellular processes

    • Perform dose-response analyses to correlate inhibition with biofilm effects

  • Multifactorial Experimental Design:
    When studying factors like rhamnolipids, which have been shown to significantly impact T. denitrificans adhesion , implement:

    • Full factorial experimental designs

    • Statistical methods to separate variables (ANOVA, multiple regression)

    • Machine learning approaches for complex datasets

Data Interpretation Framework:

ObservationPossible MsbA InvolvementAlternative ExplanationDiscriminating Experiment
Altered biofilm formationDirect effect on lipid A transportGeneral membrane disruptionCompare with other membrane protein mutants
Changed response to rhamnolipidsMsbA-rhamnolipid interactionAltered cell surface hydrophobicitySurface property measurements with purified components
Temperature sensitivityMsbA conformational changesGeneral metabolic effectsIn vitro MsbA activity assays at different temperatures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.