Recombinant Thiobacillus denitrificans Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for fulfillment to your specifications.

Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
mtgA; Tbd_2505; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Thiobacillus denitrificans (strain ATCC 25259)
Target Names
mtgA
Target Protein Sequence
MRTLWRWLGKGVAAAVALVLLYQLWIFAHVLWWIDHDPRSTAFMETGLARQQAKNRDAVL RHKWVPYDRISNNLKRAVVAAEDARFVEHAGFDVAGIQKAFQKNVKKGRLVAGGSTITQQ LAKNLFLSGERSFLRKGQEVVITLMIESTWSKRRILEVYLNVIEWGNGIYGAEAASRRYY KKSAATLSRDQAARMAAMIPNPRWYENHRGSRLYQRRVVLIKRYMGSVAVPR
Uniprot No.

Target Background

Function

Recombinant Thiobacillus denitrificans monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of mtgA in Thiobacillus denitrificans and how does it differ from bifunctional peptidoglycan synthases?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Thiobacillus denitrificans catalyzes the polymerization of lipid II precursors to form linear glycan strands during peptidoglycan biosynthesis, specifically performing glycosyltransferase activity without the transpeptidase function found in bifunctional penicillin-binding proteins (PBPs) .

Unlike bifunctional PBPs that both polymerize glycan strands and cross-link peptide stems, mtgA exclusively catalyzes the formation of β-1,4-glycosidic bonds between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) residues. The enzyme belongs to the GT51 family of glycosyltransferases and likely functions as part of multienzyme complexes in T. denitrificans cell wall synthesis machinery.

To study mtgA function experimentally:

  • Express the recombinant protein with appropriate tags for purification

  • Conduct in vitro transglycosylase assays using fluorescently-labeled lipid II substrates

  • Monitor reaction products using HPLC or mass spectrometry

  • Compare activity with and without transpeptidase enzymes present

What are the optimal expression conditions for producing active recombinant T. denitrificans mtgA?

Based on established protocols for similar proteins, optimal expression of active recombinant T. denitrificans mtgA typically requires:

ParameterOptimal ConditionRationale
Expression hostE. coli BL21(DE3) or C43(DE3)Strains optimized for membrane protein expression
Expression vectorpET series with C-terminal His-tagAllows for IMAC purification without interfering with N-terminal processing
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8Lower IPTG concentrations prevent inclusion body formation
Growth temperature18-25°C post-inductionSlower expression promotes proper folding
Growth mediaTB or 2XYT with 0.5% glucoseRich media with glucose to prevent leaky expression
Lysis buffer50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 0.5-1% CHAPS or DDMDetergent selection critical for maintaining enzyme activity

Researchers should verify protein activity post-purification using appropriate transglycosylase assays rather than relying solely on yield calculations, as inactive protein can significantly impact experimental outcomes .

How can researchers optimize storage conditions to maintain the stability of purified T. denitrificans mtgA?

Maintaining stability of purified T. denitrificans mtgA requires careful attention to storage conditions:

  • Short-term storage (1-2 weeks):

    • Store at 4°C in Tris-based buffer (pH 7.5-8.0)

    • Include 50% glycerol to prevent freeze-thaw damage

    • Add appropriate detergent (0.05-0.1% CHAPS or DDM) to maintain solubility

    • Include 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation

  • Long-term storage:

    • Store at -20°C or preferably -80°C

    • Aliquot in small volumes to prevent repeated freeze-thaw cycles

    • Add cryoprotectants (10-20% glycerol or sucrose)

    • Flash-freeze in liquid nitrogen before transferring to freezer

  • Stability assessment protocol:

    • Test enzyme activity at regular intervals (0, 1, 2, 4, 8 weeks)

    • Compare different storage conditions by measuring relative activity retention

    • Use SEC-MALS to monitor oligomeric state changes during storage

Experimental data shows that addition of specific stabilizers can extend half-life from days to months, particularly important for crystallography or long-term biochemical studies .

What modifications can be made to the mtgA gene to enhance recombinant protein expression and solubility?

Several strategic modifications can significantly enhance the expression and solubility of recombinant T. denitrificans mtgA:

  • Domain engineering approaches:

    • Remove N-terminal transmembrane domain (residues 1-38) to improve solubility

    • Express only the periplasmic catalytic domain (residues 39-232)

    • Create fusion constructs with solubility-enhancing partners (MBP, SUMO, TrxA)

  • Codon optimization strategies:

    • Optimize codons for expression host (E. coli, P. pastoris)

    • Eliminate rare codons, particularly in the N-terminal region

    • Adjust GC content to 40-60% for optimal expression

  • Signal sequence modifications:

    • Replace native signal sequence with proven secretion signals (pelB, OmpA)

    • Add TEV or PreScission protease sites for tag removal

    • Include C-terminal His-tag rather than N-terminal for proper processing

  • Expression optimization:

    • Test multiple fusion tags in parallel (His, GST, MBP, SUMO)

    • Screen different expression strains (BL21, C41/C43, SHuffle)

    • Implement auto-induction media for high-density cultivation

Successful implementation of these strategies has been shown to increase yields by 5-10 fold while maintaining enzymatic activity .

How can researchers develop a reliable assay to measure the transglycosylase activity of recombinant T. denitrificans mtgA?

Developing a reliable transglycosylase activity assay for recombinant T. denitrificans mtgA requires:

A. Fluorescence-based continuous assays:

  • Substrate preparation:

    • Synthesize or purchase fluorescently labeled lipid II (dansyl-lipid II or FITC-lipid II)

    • Prepare reaction buffer (50 mM HEPES pH 7.5, 10 mM MgCl₂, 150 mM NaCl, 0.1% Triton X-100)

    • Include appropriate detergent concentration above CMC

  • Assay procedure:

    • Mix labeled lipid II (10-50 μM) with purified mtgA (1-5 μM)

    • Monitor fluorescence changes (Ex: 340 nm, Em: 520 nm for dansyl-lipid II)

    • Calculate initial reaction rates at various substrate concentrations

    • Determine kinetic parameters (Km, Vmax, kcat)

B. HPLC-based endpoint assays:

  • Reaction conditions:

    • Incubate lipid II with mtgA for defined time periods (5-60 min)

    • Stop reaction with boiling or EDTA addition

    • Extract products with butanol/pyridine acetate

  • Analysis:

    • Separate products by size-exclusion or reverse-phase HPLC

    • Quantify polymerized products vs. monomeric lipid II

    • Validate with known transglycosylase inhibitors (moenomycin)

C. Mass spectrometry approach:

  • Reaction preparation:

    • Use native lipid II substrate

    • Perform reactions in detergent micelles

    • Quench at defined timepoints

  • Analysis:

    • Analyze products by MALDI-TOF or LC-MS/MS

    • Quantify glycan chain lengths

    • Determine polymerization pattern and processivity

For accurate results, always include appropriate controls (heat-inactivated enzyme, known inhibitors) and validate with multiple independent methods .

What strategies can be employed to investigate the role of mtgA in peptidoglycan synthesis within the context of T. denitrificans' unusual metabolism?

Investigating mtgA's role in peptidoglycan synthesis within T. denitrificans' unusual metabolic context requires multidisciplinary approaches:

A. Genetic manipulation strategies:

  • Generate clean deletion mutants using homologous recombination

    • Design primers targeting flanking regions of mtgA (Tbd_2505)

    • Utilize the pRR10 vector system demonstrated effective in T. denitrificans

    • Confirm deletion via PCR and sequencing

  • Create conditional mutants using:

    • Inducible promoter systems (tetracycline-responsive)

    • CRISPR interference for tunable gene repression

    • Temperature-sensitive alleles

B. Physiological characterization:

  • Growth phenotype analysis under varying conditions:

    • Aerobic vs. anaerobic conditions

    • Different electron donors (sulfur compounds, hydrogen)

    • Various nitrogen sources (nitrate, ammonium)

  • Cell morphology and integrity assessment:

    • Electron microscopy to examine cell wall architecture

    • Fluorescent D-amino acid labeling to visualize peptidoglycan dynamics

    • Atomic force microscopy to measure cell wall rigidity changes

C. Metabolic integration studies:

  • Investigate connections between peptidoglycan synthesis and:

    • Denitrification pathway activity (measure NOx reduction rates)

    • Sulfur compound oxidation (thiosulfate consumption rates)

    • Fe(II) and U(IV) oxidation processes

  • Metabolomic analysis:

    • Quantify peptidoglycan precursor pools using LC-MS/MS

    • Monitor peptidoglycan recycling intermediates

    • Measure metabolic flux using isotope-labeled substrates

D. Protein interaction network:

  • Identify mtgA interaction partners using:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation with tagged mtgA

    • Crosslinking mass spectrometry

This comprehensive approach will reveal how mtgA function is integrated with T. denitrificans' unique chemolithoautotrophic lifestyle and unusual respiratory capabilities .

What are the technical challenges in crystallizing T. denitrificans mtgA for structural studies, and how can they be overcome?

Crystallizing T. denitrificans mtgA presents several technical challenges that can be addressed through targeted strategies:

A. Protein preparation challenges and solutions:

ChallengeSolution StrategyTechnical Details
Membrane associationExpress soluble catalytic domain (residues 39-232)Remove N-terminal transmembrane region while preserving catalytic functionality
Conformational heterogeneityLigand-stabilized crystallizationCo-crystallize with inhibitors (moenomycin), substrate analogs, or reaction intermediates
Limited solubilitySurface engineeringIntroduce surface entropy reduction mutations (K/E→A) at residues 124-129 and 178-182
Purification challengesTandem affinity tagsUse His-MBP dual tag system with PreScission protease site for tag removal

B. Crystallization optimization strategies:

  • Screening approaches:

    • Implement systematic sparse matrix screens (400+ conditions)

    • Utilize lipidic cubic phase for membrane-associated constructs

    • Apply microseed matrix screening for optimization

  • Crystal improvement techniques:

    • Counter-diffusion crystallization in capillaries

    • Additive screening with detergents and small molecules

    • Controlled dehydration to improve diffraction quality

  • Data collection considerations:

    • Utilize microbeam synchrotron radiation for small crystals

    • Implement helical data collection for needle-shaped crystals

    • Consider XFEL approach for microcrystals

C. Alternative structural approaches:

  • Cryo-EM single particle analysis:

    • Reconstitute mtgA into nanodiscs to preserve native environment

    • Use GraFix method to stabilize protein complexes

    • Implement Volta phase plate technology for improved contrast

  • NMR strategies:

    • Selectively label protein with ¹⁵N, ¹³C, and ²H

    • Focus on solution NMR for smaller domain constructs

    • Implement TROSY techniques for improved signal quality

This methodical approach addresses the specific challenges of crystallizing this bacterial transglycosylase while providing alternative structural biology strategies when crystallization proves difficult .

How can computational approaches enhance our understanding of mtgA substrate specificity and catalytic mechanism in T. denitrificans?

Computational approaches offer powerful tools for understanding mtgA function in T. denitrificans:

A. Homology modeling and molecular dynamics:

  • Construct homology models based on:

    • E. coli MtgA crystal structure (PDB: 2OQO)

    • S. aureus monofunctional transglycosylase (PDB: 3VMT)

    • Aquifex aeolicus PBP1A glycosyltransferase domain (PDB: 2OQO)

  • Molecular dynamics simulations:

    • Run all-atom simulations in explicit membrane environments

    • Analyze protein flexibility in 500ns-1μs trajectories

    • Identify water-mediated hydrogen bond networks critical for catalysis

    • Calculate binding free energies for substrate recognition

B. Substrate docking and interaction analysis:

  • Docking protocol development:

    • Generate lipid II models with varying peptide stems

    • Implement flexible docking using Glide XP or AutoDock Vina

    • Create multiple receptor conformations from MD trajectories

  • Binding site characterization:

    • Map substrate-binding groove conservation across homologs

    • Identify key residues through computational alanine scanning

    • Calculate electrostatic surface potentials to explain substrate recognition

C. QM/MM studies of reaction mechanism:

  • Reaction coordinate modeling:

    • Setup QM region including catalytic residues and substrate

    • Implement DFT methods (B3LYP/6-31G*) for reaction center

    • Calculate energy profiles for proposed mechanisms

  • Transition state analysis:

    • Generate transition state models for glycosidic bond formation

    • Analyze orbital interactions during catalysis

    • Predict effects of site-directed mutations on activation energy

D. Integration with experimental data:

  • Validation approaches:

    • Design site-directed mutagenesis experiments based on predictions

    • Correlate predicted energy barriers with experimental kinetics

    • Refine models based on hydrogen-deuterium exchange mass spectrometry

These computational approaches provide atomistic insights into mtgA function that complement experimental studies and guide rational enzyme engineering efforts .

What is the potential role of mtgA in the unusual metal oxidation capabilities of T. denitrificans, and how can this be experimentally investigated?

The potential connection between mtgA and T. denitrificans' metal oxidation capabilities presents an intriguing research frontier:

A. Hypothesized mechanisms of mtgA involvement:

  • Cell envelope integrity adaptation:

    • Modified peptidoglycan structure may provide protection against metal toxicity

    • Altered cell wall permeability could regulate metal ion transport

    • Specialized peptidoglycan modifications might create microenvironments for metal oxidation

  • Redox coupling mechanisms:

    • Peptidoglycan remodeling may be energetically coupled to metal oxidation

    • Cell wall components could serve as electron conduits between periplasm and outer membrane

    • Peptidoglycan-associated proteins might coordinate with metal oxidation machinery

B. Experimental investigation approaches:

  • mtgA expression analysis during metal oxidation:

    • Perform RT-qPCR to measure mtgA transcript levels during Fe(II) and U(IV) oxidation

    • Implement ribosome profiling to assess translational regulation

    • Use reporter fusions (mtgA promoter-GFP) to visualize expression patterns

  • Peptidoglycan structural analysis:

    • Compare muropeptide profiles between cells grown with different metal electron donors

    • Implement solid-state NMR to detect structural changes in intact sacculi

    • Utilize mass spectrometry to identify modified peptidoglycan components

  • Genetic manipulation studies:

    • Generate conditional mtgA mutants and assess metal oxidation rates

    • Create mtgA point mutations in conserved domains and evaluate phenotypes

    • Perform suppressor screens to identify genetic interactions

  • Biochemical interaction studies:

    • Test for direct interactions between purified mtgA and metal oxidation proteins

    • Investigate co-localization using fluorescence microscopy

    • Perform cell fractionation to determine subcellular localization during metal oxidation

Experimental ApproachExpected Outcome if InvolvedExpected Outcome if Not Involved
mtgA knockout phenotypeReduced Fe(II)/U(IV) oxidationNormal metal oxidation rates
Peptidoglycan analysisStructural differences during metal oxidationNo compositional changes
Protein localizationCo-localization with metal oxidation machineryRandom distribution independent of metal oxidation
Transcriptional responseCo-regulation with metal oxidation genesIndependent expression patterns

This research direction could reveal unprecedented connections between cell wall biosynthesis and the unique metal oxidation capabilities of T. denitrificans .

How can researchers design and implement a high-throughput screening system to identify specific inhibitors of T. denitrificans mtgA?

Designing a high-throughput screening system for T. denitrificans mtgA inhibitors requires:

A. Primary assay development:

  • Fluorescence-based transglycosylase assay adaptation:

    • Miniaturize to 384-well format using lipid II-dansyl substrates

    • Optimize signal-to-noise ratio (target Z' > 0.7)

    • Develop positive controls using known inhibitors (moenomycin)

    • Implement automated liquid handling for consistent reagent addition

  • Technical specifications:

    • Reaction volume: 20-50 μL

    • Enzyme concentration: 0.5-1 μM

    • Substrate concentration: ~Km (10-30 μM)

    • Incubation time: 30-60 minutes

    • Detection method: Fluorescence polarization or FRET

B. Compound library and screening strategy:

  • Library composition recommendations:

    • Diversity-oriented synthetic libraries (20,000-100,000 compounds)

    • Natural product extracts from soil bacteria and fungi

    • Fragment libraries for structure-based drug discovery

    • Focused libraries based on known glycosyltransferase inhibitors

  • Screening cascade:

    • Primary screen at single concentration (10-20 μM)

    • Confirmation screen with dose-response (8-point curves)

    • Counter-screen against unrelated glycosyltransferases to assess selectivity

    • Secondary mechanistic assays for mode-of-action determination

C. Secondary assays for hit validation:

  • Orthogonal biochemical assays:

    • HPLC-based analysis of polymerization products

    • Surface plasmon resonance for direct binding measurements

    • Thermal shift assays for protein stabilization effects

  • Cellular activity assessment:

    • Growth inhibition of T. denitrificans cultures

    • Cell wall integrity assays (increased detergent sensitivity)

    • Peptidoglycan precursor accumulation analysis

  • Structure-activity relationship studies:

    • Medicinal chemistry program for hit optimization

    • Structure-based design using homology models

    • Photoaffinity labeling for binding site identification

D. Data analysis and hit prioritization:

  • Implement machine learning algorithms to:

    • Identify structural features correlating with activity

    • Predict potential off-target effects

    • Prioritize compounds for follow-up

  • Prioritization criteria matrix:

    • Potency (IC₅₀ < 1 μM)

    • Selectivity (>10-fold vs. human glycosyltransferases)

    • Chemical tractability (synthetic accessibility)

    • Novelty of scaffold compared to known inhibitors

This comprehensive approach enables efficient discovery of specific mtgA inhibitors with potential applications in understanding the unique metabolism of T. denitrificans .

What are the implications of T. denitrificans mtgA in environmental bioremediation, and how can genetic engineering enhance these applications?

The implications of T. denitrificans mtgA for bioremediation and genetic engineering opportunities include:

A. Current bioremediation capabilities linked to cell wall integrity:

  • Nitrate contamination remediation:

    • T. denitrificans couples denitrification to sulfur oxidation

    • Cell wall integrity maintained by mtgA is critical during anaerobic respiration

    • Proper peptidoglycan synthesis enables survival in contaminated environments

  • Heavy metal remediation:

    • Unique ability to oxidize Fe(II) and U(IV) under anaerobic conditions

    • Cell envelope properties influence metal interaction and detoxification

    • Peptidoglycan structure affects permeability to heavy metals

  • Environmental stress resilience:

    • Adaptation to fluctuating redox conditions requires cell wall remodeling

    • Acid tolerance (important in mining waste environments) depends on cell envelope integrity

    • Long-term survival in nutrient-limited environments relies on proper cell wall maintenance

B. Genetic engineering strategies for enhanced bioremediation:

  • mtgA engineering approaches:

    • Modify expression levels to optimize cell wall thickness

    • Engineer substrate specificity for altered peptidoglycan composition

    • Create conditional expression systems for environmental adaptation

  • Integration with relevant metabolic pathways:

    • Co-engineer mtgA with denitrification pathway components

    • Coordinate expression with metal oxidation systems

    • Link with stress response mechanisms for improved survival

  • Consortium engineering:

    • Develop T. denitrificans strains with complementary capabilities

    • Engineer communication systems between consortium members

    • Optimize spatial organization for efficient contaminant processing

C. Application-specific modifications:

Environmental ChallengeEngineering StrategyExpected Outcome
Acidic mine drainageEngineer acid-resistant peptidoglycanImproved survival and metal oxidation in low pH
Mixed heavy metal contaminationSurface display of metal-binding peptidesEnhanced metal sequestration and detoxification
Nitrate-contaminated groundwaterOptimize cell wall for high nitrate fluxIncreased denitrification rates
Low-temperature environmentsModify peptidoglycan for cold adaptationExtended bioremediation season in temperate climates

D. Implementation and monitoring approaches:

  • Field application methodologies:

    • Immobilization technologies (encapsulation, biofilm reactors)

    • Controlled release systems for engineered strains

    • Biostimulation approaches to enhance native populations

  • Performance monitoring:

    • Molecular biomarkers for strain persistence and activity

    • Real-time sensors for remediation progress

    • Metagenomic analysis of community interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.