Recombinant Thiobacillus denitrificans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to NADH-Quinone Oxidoreductase Subunit K (nuoK)

NADH-quinone oxidoreductase (NDH-1) is a multi-subunit membrane-bound enzyme complex involved in the electron transport chain. Subunit K (nuoK) is one of 14 subunits in the NDH-1 complex, implicated in quinone binding and electron transfer . The recombinant form of nuoK from Thiobacillus denitrificans has been engineered for biochemical and structural studies, enabling insights into its role in microbial respiration.

Electron Transfer and Proton Translocation

  • Quinone Binding: NuoK facilitates electron transfer from NADH to ubiquinone, coupled with proton translocation across the membrane .

  • Iron-Sulfur Clusters: While nuoK itself does not bind iron-sulfur clusters, adjacent subunits (e.g., NuoB, NuoI) ligate [4Fe-4S] clusters critical for electron transport .

Role in Energy Conservation

The NDH-1 complex generates a proton motive force, driving ATP synthesis. Mutations in nuoK disrupt quinone reduction efficiency, highlighting its role in coupling electron transfer to proton pumping .

Expression System

  • Host: Escherichia coli (cytoplasmic expression) .

  • Tag: N-terminal His-tag for affinity chromatography.

Mechanistic Studies

  • Inhibitor Binding: Used to study interactions with ubiquinone analogs (e.g., HQNO) and respiratory chain inhibitors .

  • Structural Biology: Facilitates crystallization trials to resolve NDH-1 architecture .

Industrial Relevance

  • Bioremediation: Thiobacillus denitrificans is used in sulfur and nitrate removal systems; understanding nuoK aids in optimizing metabolic pathways .

Comparative Analysis with Homologs

OrganismSubunit K FeaturesReference
Paracoccus denitrificansMembrane-anchored via N-terminal hydrophobic domain
Escherichia coliBinds ubiquinone at the P-side of the membrane
Sulfurimonas denitrificansShares 67% sequence identity with T. denitrificans

Challenges and Future Directions

  • Structural Resolution: Full-length crystal structures of nuoK are lacking, necessitating advanced cryo-EM studies.

  • Functional Mutagenesis: Targeted mutations (e.g., G140A, E144C) could elucidate mechanistic roles in proton translocation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please specify them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Tbd_1152; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Thiobacillus denitrificans (strain ATCC 25259)
Target Names
nuoK
Target Protein Sequence
MISLSHFLVLGGVLFAIAVLGIFLNRKNVIVLLMAIELMLLAVNMNFIAFSHYLGDVHGQ VFVFFILTVAAAESAIGLAILVLLFRNLRTINVDDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does NADH-quinone oxidoreductase contribute to the unusual metabolism of T. denitrificans?

NADH-quinone oxidoreductase serves as a key component in the respiratory chain of T. denitrificans, facilitating electron transfer processes that support the organism's unique metabolic capabilities. T. denitrificans exhibits an environmentally significant metabolic repertoire, including the coupling of denitrification to sulfur compound oxidation and anaerobic oxidation of Fe(II) and U(IV) . The NADH-quinone oxidoreductase complex likely plays an essential role in these processes by helping establish the proton gradient necessary for energy conservation during chemolithoautotrophic growth under various environmental conditions.

How is the genetic manipulation of T. denitrificans achieved for studying nuoK?

Genetic manipulation of T. denitrificans can be achieved through the established genetic system that enables insertion mutations via homologous recombination and complementation in trans. The procedure involves:

  • Characterization of antibiotic sensitivity profiles

  • Transformation with foreign DNA via electroporation

  • Generation of insertion mutations through in vitro transposition

  • PCR amplification of mutated genes

  • Introduction of amplicons into T. denitrificans by electroporation

  • Use of the IncP plasmid pRR10 as a vector for complementation

This genetic system has been successfully demonstrated with the hynL gene encoding a [NiFe]hydrogenase large subunit, where interruption resulted in 75% decreased activity, while complementation increased activity by 50% compared to wild type .

What are the optimal expression conditions for producing recombinant nuoK from T. denitrificans?

For optimal expression of recombinant nuoK from T. denitrificans, researchers should consider:

  • Host Selection: E. coli expression systems (particularly C41(DE3) or C43(DE3) strains) designed for membrane proteins can be used, though expression in the native organism may yield better results for functional studies.

  • Vector Design: Incorporating the gene with its native regulatory elements or with controlled promoter systems. Based on successful approaches with other T. denitrificans genes, amplifying the nuoK gene with Vent DNA polymerase (or similar high-fidelity polymerases) and introducing appropriate restriction sites for cloning is recommended .

  • Culture Conditions:

    • For heterologous expression: Lower temperatures (16-20°C) after induction

    • For homologous expression: Anaerobic conditions with appropriate electron donors and acceptors

    • Selective media with appropriate antibiotics based on the characterized sensitivity profile of T. denitrificans

  • Purification Strategy: Due to the transmembrane nature of nuoK, detergent-based extraction (e.g., DDM or LDAO) followed by affinity chromatography is recommended when using tagged constructs.

How can researchers functionally characterize the nuoK subunit in isolation from the complete NADH-quinone oxidoreductase complex?

Functional characterization of isolated nuoK presents significant challenges due to its integrated role within the larger NADH-quinone oxidoreductase complex. Methodological approaches include:

  • Complementation Studies: Generate nuoK knockout mutants in T. denitrificans using the established genetic system, then complement with wild-type or modified versions of nuoK to assess functionality .

  • Membrane Reconstitution: Purify recombinant nuoK and reconstitute into liposomes or nanodiscs to study its contribution to proton translocation, potentially using pH-sensitive fluorescent dyes to monitor changes.

  • Cross-linking Studies: Employ chemical cross-linking coupled with mass spectrometry to identify interaction partners and orientation within the complex.

  • Cysteine-scanning Mutagenesis: Systematically replace residues with cysteine to probe structural elements and accessibility, similar to approaches used for other oxidoreductase subunits like those in the NQR complex from Vibrio species .

  • Comparative Analysis: Utilize information from well-characterized homologous systems, such as those from Vibrio cholerae, where subunit-specific roles have been established through targeted mutagenesis .

What approaches can be used to investigate the interplay between nuoK and the [NiFe]hydrogenases identified in T. denitrificans?

Investigating the potential functional relationship between nuoK and the [NiFe]hydrogenases in T. denitrificans requires multifaceted approaches:

  • Double Mutant Analysis: Generate mutants with disruptions in both nuoK and hydrogenase genes (e.g., hynL) to assess synergistic effects on metabolism and growth under various conditions, particularly during nitrate-dependent oxidation processes .

  • Transcriptional Co-regulation Studies: Use RT-PCR or RNA-Seq to determine if nuoK and hydrogenase genes show coordinated expression patterns under different growth conditions.

  • Protein-Protein Interaction Assays: Employ co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling approaches to identify potential direct interactions between nuoK and hydrogenase components.

  • Metabolic Flux Analysis: Track electron flow through respiratory pathways in wild-type versus mutant strains during growth on different substrates.

  • Enzymatic Activity Assays: Compare NADH-quinone oxidoreductase activity in wild-type, nuoK mutant, and hydrogenase mutant strains to identify potential functional coupling between these enzyme systems.

This approach is particularly relevant given the observation that hydrogen oxidation appears to be required for nitrate-dependent U(IV) oxidation in T. denitrificans, suggesting potential electron transfer connections between these systems .

What structural features of nuoK are critical for proton translocation in T. denitrificans?

Based on structural studies of homologous proteins, critical features of nuoK likely include:

  • Conserved Charged Residues: Specific glutamate, aspartate, lysine, or histidine residues within transmembrane domains that may participate directly in proton transfer pathways.

  • Transmembrane Helices Arrangement: The precise orientation and packing of the transmembrane α-helices, which form part of the proton channel through the membrane.

  • Quinone-binding Interface Contributions: Potential involvement in forming the quinone-binding pocket, as seen in NADH:quinone oxidoreductase from related organisms where specific subunits contribute to creating the active site .

  • Conserved Motifs: Identification of any conserved sequence motifs across bacterial NADH-quinone oxidoreductases that may indicate functional hotspots.

Structural determination through X-ray crystallography or cryo-EM of the complete complex would provide definitive information, though this represents a significant technical challenge given the membrane-bound nature of the complex.

How do post-translational modifications affect nuoK function in T. denitrificans?

Research on related oxidoreductases suggests several potential post-translational modifications that may affect nuoK function:

  • Flavin Attachment: While nuoK itself may not directly bind flavin cofactors, other subunits in the NADH:quinone oxidoreductase complex may undergo covalent flavin attachment, as seen in the Na+-NQR complex from Vibrio cholerae where FMN is covalently attached to threonine residues in specific subunits .

  • Iron-Sulfur Cluster Assembly: The complex may contain iron-sulfur clusters that require specific assembly factors, similar to the [2Fe-2S] cluster found in the Na+-NQR complex .

  • Membrane Insertion and Complex Assembly: Proper insertion of nuoK into the membrane and its association with other complex components may require specific chaperones or assembly factors, similar to NqrM which has been identified as a maturation factor for the Na+-NQR complex in proteobacteria .

  • Phosphorylation: Potential regulatory phosphorylation sites might influence complex activity or assembly under different metabolic conditions.

Experimental approaches to study these modifications include mass spectrometry analysis of purified nuoK, mutational analysis of potential modification sites, and comparative proteomic analysis under different growth conditions.

What are the technical challenges in crystallizing recombinant nuoK for structural determination?

Crystallization of membrane proteins like nuoK presents several specific challenges:

  • Detergent Selection:

    • The choice of detergent critically affects protein stability and crystal formation

    • Systematic screening of detergents (maltosides, glucosides, fos-cholines) is necessary

    • Detergent concentration must be optimized to maintain a monodisperse sample

  • Expression and Purification Barriers:

    • Low natural abundance requires recombinant overexpression

    • Risk of misfolding or aggregation during heterologous expression

    • Need for affinity tags that don't interfere with structure or function

    • Multiple purification steps required to achieve crystallography-grade purity

  • Crystallization Conditions:

    • Limited polar surface area reduces crystal contact points

    • Detergent micelles may interfere with crystal packing

    • Need for lipid addition to stabilize native conformation

    • Requirement for specialized crystallization methods (in meso/lipidic cubic phase approaches)

  • Alternative Approaches:

    • Cryo-EM analysis of the intact complex may be more feasible

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

    • Co-crystallization with antibody fragments to increase polar surface area

What assays are most effective for measuring NADH-quinone oxidoreductase activity in T. denitrificans?

Several complementary approaches can be used to assess NADH-quinone oxidoreductase activity:

  • Spectrophotometric Assays:

    • NADH oxidation can be monitored by the decrease in absorbance at 340 nm

    • Artificial electron acceptors like ferricyanide or dichlorophenolindophenol can be used

    • Quinone reduction can be monitored by absorbance changes specific to the quinone used

  • Oxygen Consumption Assays:

    • Clark-type electrode measurements can track oxygen consumption when using aerobic membranes

    • This approach requires careful control experiments to distinguish specific NADH-quinone oxidoreductase activity from other respiratory enzymes

  • Membrane Potential Measurements:

    • Voltage-sensitive dyes can be used to monitor the generation of membrane potential by the enzyme complex

    • Allows assessment of the coupling between electron transfer and proton translocation

  • Inhibitor Studies:

    • Specific inhibitors like rotenone or piericidin A can be used to distinguish complex I activity

    • DBMIB (2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone) has been shown to inhibit quinone reduction by Na+-NQR and could potentially be used for comparative studies

A comparative approach similar to that used for the hynL mutant, where specific hydrogenase activity was measured and compared between wild-type, mutant, and complemented strains, would be valuable for nuoK functional analysis .

How can researchers differentiate between the activities of NADH-quinone oxidoreductase and other oxidoreductases in T. denitrificans?

Differentiating between various oxidoreductase activities requires a systematic approach:

  • Selective Substrate Utilization:

    • NADH vs. NADPH specificity

    • Different quinone analogs (ubiquinone vs. menaquinone derivatives)

    • Comparison with alternative electron donors like succinate or formate

  • Inhibitor Profiling:

    EnzymeSelective InhibitorsConcentration Range
    Complex I (NADH:quinone oxidoreductase)Rotenone, piericidin A1-10 μM
    Alternative NADH dehydrogenasesFlavone50-100 μM
    Succinate dehydrogenaseMalonate, thenoyltrifluoroacetone1-5 mM
    Na+-NQR-like enzymesHQNO (2-n-heptyl-4-hydroxyquinoline N-oxide)10-50 μM
  • Genetic Approaches:

    • Creation of knockout mutants for specific oxidoreductase components

    • Complementation studies with wild-type or modified genes

    • This approach has been demonstrated to be effective in T. denitrificans with the established genetic system

  • Subcellular Fractionation:

    • Separate membrane from cytosolic fractions

    • Further separate inner and outer membranes if possible

    • Characterize activity distribution across fractions

  • Mass Spectrometry-Based Proteomics:

    • Identify and quantify oxidoreductase components under different growth conditions

    • Correlate protein abundance with measured activities

What are the optimal buffer conditions for maintaining stability of recombinant nuoK during purification?

Based on experience with similar membrane proteins, the following buffer conditions are recommended:

  • Buffer Composition:

    • Base buffer: 50 mM potassium phosphate or HEPES-KOH (pH 7.0-7.5)

    • Salt: 100-300 mM NaCl or KCl to maintain ionic strength

    • Glycerol: 10-20% to enhance protein stability

    • Reducing agent: 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation of cysteine residues

  • Detergent Selection:

    • Primary extraction: n-dodecyl-β-D-maltoside (DDM) at 1-2% (w/v)

    • Buffer maintenance: 0.02-0.05% DDM (above CMC)

    • Alternative detergents: LDAO, Cymal-6, or digitonin depending on downstream applications

  • Stabilizing Additives:

    • Lipids: Addition of E. coli polar lipid extract (0.01-0.05 mg/mL)

    • Specific cofactors: Consider adding quinone analogs at low concentrations

    • Protease inhibitors: Complete cocktail or specific inhibitors for serine and cysteine proteases

  • Storage Considerations:

    • Temperature: 4°C for short-term, -80°C with flash-freezing in liquid nitrogen for long-term

    • Avoid multiple freeze-thaw cycles

    • Consider addition of sucrose (10%) for freeze protection

  • Quality Control:

    • Monitor sample homogeneity by size-exclusion chromatography

    • Assess protein stability over time using activity assays and SDS-PAGE

    • Consider thermal stability assays to optimize buffer conditions

How does the expression of nuoK vary under different growth conditions in T. denitrificans?

While specific data on nuoK expression in T. denitrificans is limited, research on related systems suggests the following patterns may occur:

  • Electron Donor Availability:

    • Expression likely increases during growth on reduced sulfur compounds

    • May be differentially regulated when switching between different electron donors

  • Oxygen Tension:

    • Likely upregulated under anaerobic denitrifying conditions

    • May show distinct expression patterns during transitions between aerobic and anaerobic growth

  • Alternative Electron Acceptors:

    • Different expression levels may occur with nitrate versus nitrite as terminal electron acceptors

    • Expression patterns may shift during uranium or iron oxidation

  • Carbon Source Effects:

    • As T. denitrificans is chemolithoautotrophic, CO₂ availability and fixation rates may indirectly influence nuoK expression

    • Potential co-regulation with carbon fixation pathways

  • Experimental Approaches to Study Expression:

    • qRT-PCR to quantify transcript levels under different conditions

    • Promoter-reporter fusions to monitor expression patterns in real-time

    • Proteomic analysis to correlate transcript and protein levels

    • Utilize the established genetic system for T. denitrificans to create reporter constructs

What is the relationship between nuoK function and the ability of T. denitrificans to perform anaerobic, nitrate-dependent oxidation of Fe(II) and U(IV)?

The relationship between nuoK and anaerobic oxidation capabilities likely involves:

  • Electron Transport Chain Integration:

    • NADH-quinone oxidoreductase containing nuoK may serve as a critical electron sink during anaerobic oxidation processes

    • The complex likely contributes to maintaining redox balance during Fe(II) and U(IV) oxidation

  • Energy Conservation:

    • Proton translocation by the complex containing nuoK contributes to the proton motive force needed for ATP synthesis during chemolithoautotrophic growth

    • This energy conservation is essential for the energetically challenging process of anaerobic metal oxidation

  • Potential Interaction with Hydrogenases:

    • Research has shown that hydrogen oxidation appears to be required for nitrate-dependent U(IV) oxidation in T. denitrificans

    • The relationship between hydrogenases and the NADH-quinone oxidoreductase complex containing nuoK may be crucial for this process

    • The established genetic system could be used to create double mutants (nuoK and hydrogenase genes) to explore this relationship

  • Reverse Electron Transport:

    • The complex may participate in reverse electron transport during oxidation of Fe(II) and U(IV), which have very positive redox potentials

    • This process would require energy input, potentially through the proton gradient

How does the structure and function of nuoK in T. denitrificans compare to homologous subunits in other organisms with different metabolic capabilities?

Comparative analysis reveals both conservation and specialization:

  • Conservation Across Species:

    • Core structural features of nuoK are likely conserved across bacteria with NADH-quinone oxidoreductase complexes

    • Transmembrane topology and key charged residues involved in proton translocation would show high conservation

  • Comparison with Other Autotrophs:

    • Similarities may exist with nuoK from other chemolithoautotrophs like Acidithiobacillus ferrooxidans

    • Specialized features may relate to electron donor flexibility in T. denitrificans

  • Differences from Na⁺-translocating NQR Systems:

    • Na⁺-NQR systems from organisms like Vibrio cholerae use Na⁺ rather than H⁺ for ion translocation

    • These systems utilize different subunits (NqrB, NqrC, NqrD, NqrE) with unique cofactor arrangements including covalently attached FMN

    • The NqrB and NqrC subunits each carry one covalently attached FMN via phosphodiester bonds to threonine residues

  • Adaptation to Environmental Niches:

    • Potential adaptations in nuoK sequence and structure may reflect the diverse extreme environments where T. denitrificans can thrive

    • These adaptations could include changes in amino acid composition affecting stability or flexibility

  • Evolutionary Analysis Approach:

    • Phylogenetic analysis of nuoK sequences across diverse bacteria

    • Identification of conserved versus variable regions

    • Correlation of sequence features with metabolic capabilities and environmental niches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.